Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.14
PubTator Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
breast carcinoma 1.300 3.5e-02
ductal carcinoma in situ 2.600 6.0e-03
esophageal adenocarcinoma 2.000 1.9e-02
fibroadenoma 2.300 4.1e-02
interstitial cystitis -1.400 4.9e-03
invasive ductal carcinoma 2.900 2.3e-03
non-small cell lung cancer -1.233 4.9e-05
osteosarcoma 1.069 4.0e-03
ovarian cancer -1.300 1.8e-03
pancreatic ductal adenocarcinoma liver m... 1.486 4.2e-02
psoriasis -1.200 9.9e-08
spina bifida -1.408 3.8e-02
ulcerative colitis -1.200 1.3e-03

 Compartment GO Term (1)

AA Sequence

MTTEIGWWKLTFLRKKKSTPKVLYEIPDTYAQTEGDAEPPRPDAGGPNSDFNTRLEKIVDKSTKGKHVKV      1 - 70
SNSGRFKEKKKVRATLAENPNLFDDHEEGRSSK                                          71 - 103
//

Text Mined References (5)

PMID Year Title