Property Summary

NCBI Gene PubMed Count 29
PubMed Score 14.15
PubTator Score 24.34

Knowledge Summary

Patent (6,767)

Expression

  Differential Expression (23)

Disease log2 FC p
astrocytic glioma 1.100 4.1e-02
ependymoma 1.900 6.3e-03
oligodendroglioma 1.400 3.5e-02
psoriasis 1.100 9.3e-04
osteosarcoma 2.236 6.1e-05
group 4 medulloblastoma 2.300 1.2e-03
atypical teratoid / rhabdoid tumor 2.100 3.7e-06
glioblastoma 1.400 1.3e-02
medulloblastoma, large-cell 2.500 7.3e-06
primitive neuroectodermal tumor 1.500 3.0e-05
hereditary spastic paraplegia -1.254 5.8e-03
Amyotrophic Lateral Sclerosis 1.042 7.2e-06
acute quadriplegic myopathy 1.128 5.4e-04
intraductal papillary-mucinous adenoma (... 1.100 1.8e-02
intraductal papillary-mucinous carcinoma... 1.400 1.2e-02
pediatric high grade glioma 1.100 4.3e-02
lung adenocarcinoma 1.678 9.2e-06
Pick disease -1.100 4.0e-03
progressive supranuclear palsy -1.700 2.1e-02
ovarian cancer 1.400 7.6e-04
Gaucher disease type 1 -1.500 8.8e-03
Down syndrome 1.100 2.8e-03
dermatomyositis 1.400 8.5e-04

Gene RIF (12)

PMID Text
26712520 PRP4K is novel estrogen regulated kinase, and its levels can be reduced by 4-OHT in ER+ breast cancer cells altering their response to taxanes
25602630 PRP4K functions as a HER2-regulated modifier of taxane sensitivity that may have prognostic value as a marker of better overall survival in taxane-treated ovarian cancer patients.
25602630 PRP4K functions as a HER2-regulated modifier of taxane sensitivity and is a prognostic biomarker for better survival in taxane-treated ovarian cancer patients. PRP4K knock-down results in "mitotic slippage" in response to taxanes, and reduced PRP4K expression is associated with both intrinsic and acquired resistance of ovarian and breast cancers to taxanes.
23686430 expression and activity are closely associated with the survival and regulation of apoptotic events in colon cancer cells
23466643 data indicate that miR-371-5p, which is highly expressed in hepatocellular carcinoma, promotes the growth of HCC cells in vitro and in vivo by activating cell cycle progression at the G1/S checkpoint by directly targeting PRPF4B
22944692 HIV-1 Rev interacting protein, pre-mRNA processing factor 4 homolog B (PRPF4B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with PRPF4B is increased by RRE
22174317 HIV-1 Rev interacting protein, pre-mRNA processing factor 4 homolog B (PRPF4B), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with PRPF4B is increased by RRE
20118938 The authors provide evidence that PRP6 and PRP31 are directly phosphorylated by human PRP4 kinase (PRP4K) concomitant with their incorporation into B complexes.
19902070 Short-term exercise resulted in a significant increase of mRNA expression of genes encoding proteins involved in the formation of precatalytic splisosome: PRPF4B.
17513757 PRP4, a serine/threonine protein kinase, is identified as a Kruppel-like factor 13 (KLF13)-binding protein; PRP4 phosphorylates KLF13
15452250 interacts specifically with HIV-2 gag
12077342 Mammalian PRP4 kinase copurifies and interacts with components of both the U5 snRNP and the N-CoR deacetylase complexes.

AA Sequence

MAAAETQSLREQPEMEDANSEKSINEENGEVSEDQSQNKHSRHKKKKHKHRSKHKKHKHSSEEDKDKKHK      1 - 70
HKHKHKKHKRKEIIDASDKEGMSPAKRTKLDDLALLEDLEKQRALIKAELDNELMEGKVQSGMGLILQGY     71 - 140
ESGSEEEGEIHEKARNGNRSSTRSSSTKGKLELVDNKITTKKRSKSRSKERTRHRSDKKKSKGGIEIVKE    141 - 210
KTTRSKSKERKKSKSPSKRSKSQDQARKSKSPTLRRRSQEKIGKARSPTDDKVKIEDKSKSKDRKKSPII    211 - 280
NESRSRDRGKKSRSPVDLRGKSKDRRSRSKERKSKRSETDKEKKPIKSPSKDASSGKENRSPSRRPGRSP    281 - 350
KRRSLSPKPRDKSRRSRSPLLNDRRSKQSKSPSRTLSPGRRAKSRSLERKRREPERRRLSSPRTRPRDDI    351 - 420
LSRRERSKDASPINRWSPTRRRSRSPIRRRSRSPLRRSRSPRRRSRSPRRRDRGRRSRSRLRRRSRSRGG    421 - 490
RRRRSRSKVKEDKFKGSLSEGMKVEQESSSDDNLEDFDVEEEDEEALIEQRRIQRQAIVQKYKYLAEDSN    491 - 560
MSVPSEPSSPQSSTRTRSPSPDDILERVAADVKEYERENVDTFEASVKAKHNLMTVEQNNGSSQKKLLAP    561 - 630
DMFTESDDMFAAYFDSARLRAAGIGKDFKENPNLRDNWTDAEGYYRVNIGEVLDKRYNVYGYTGQGVFSN    631 - 700
VVRARDNARANQEVAVKIIRNNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHKQHLCLVFEPL    701 - 770
SMNLREVLKKYGKDVGLHIKAVRSYSQQLFLALKLLKRCNILHADIKPDNILVNESKTILKLCDFGSASH    771 - 840
VADNDITPYLVSRFYRAPEIIIGKSYDYGIDMWSVGCTLYELYTGKILFPGKTNNHMLKLAMDLKGKMPN    841 - 910
KMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKKVHQLKDLL    911 - 980
DQILMLDPAKRISINQALQHAFIQEKI                                               981 - 1007
//

Text Mined References (48)

PMID Year Title
26712520 2016 Estrogen receptor alpha (ESR1)-signaling regulates the expression of the taxane-response biomarker PRP4K.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25602630 2015 PRP4K is a HER2-regulated modifier of taxane sensitivity.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23686430 2013 Curcumin induces apoptosis in human colorectal carcinoma (HCT-15) cells by regulating expression of Prp4 and p53.
23466643 2013 miR-371-5p down-regulates pre mRNA processing factor 4 homolog B (PRPF4B) and facilitates the G1/S transition in human hepatocellular carcinoma cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20118938 2010 Human PRP4 kinase is required for stable tri-snRNP association during spliceosomal B complex formation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19902070 2009 Changed profile of splicing regulator genes expression in response to exercise.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17620599 2007 Functional specialization of beta-arrestin interactions revealed by proteomic analysis.
17513757 2007 Interaction of PRP4 with Kruppel-like factor 13 regulates CCL5 transcription.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15452250 2004 Human immunodeficiency virus type 2 Gag interacts specifically with PRP4, a serine-threonine kinase, and inhibits phosphorylation of splicing factor SF2.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12077342 2002 Mammalian PRP4 kinase copurifies and interacts with components of both the U5 snRNP and the N-CoR deacetylase complexes.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11418604 2001 Cloning of human PRP4 reveals interaction with Clk1.
10799319 2000 Characterization of hPRP4 kinase activation: potential role in signaling.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9102632 1997 Functional analysis of the fission yeast Prp4 protein kinase involved in pre-mRNA splicing and isolation of a putative mammalian homologue.
8274451 1993 Identification of 21 novel human protein kinases, including 3 members of a family related to the cell cycle regulator nimA of Aspergillus nidulans.