Property Summary

NCBI Gene PubMed Count 31
PubMed Score 79.41
PubTator Score 44.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Rheumatoid Arthritis 1.200 4.3e-03
Waldenstrons macroglobulinemia 1.557 2.8e-02
Multiple myeloma 1.490 5.2e-04
esophageal adenocarcinoma 1.400 3.7e-02
psoriasis 1.400 2.3e-03
osteosarcoma 3.304 5.3e-09
glioblastoma 1.800 1.3e-06
group 4 medulloblastoma 1.600 1.5e-06
atypical teratoid / rhabdoid tumor 1.700 3.1e-07
medulloblastoma, large-cell 1.900 1.4e-05
primitive neuroectodermal tumor 1.900 1.0e-06
juvenile dermatomyositis 1.145 1.2e-09
Amyotrophic Lateral Sclerosis 1.006 1.0e-05
pancreatic ductal adenocarcinoma liver m... 1.438 4.0e-02
intraductal papillary-mucinous carcinoma... 1.200 1.1e-02
lung cancer 1.300 1.4e-04
Breast cancer 2.500 2.7e-02
pediatric high grade glioma 1.400 7.5e-06
Pick disease 1.200 9.4e-06
ovarian cancer 2.900 3.3e-07
dermatomyositis 1.800 2.0e-04

Gene RIF (8)

PMID Text
23125841 Tandem affinity purification and mass spectrometry analysis identify PRP40 pre-Mrna processing factor 40 homolog A (PRPF40A), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22408419 Study of native domain FF3-71 from human HYPA/FBP11 and the truncated version FF3-60 with C-terminal helix being deleted by molecular dynamics simulations.
21566141 Interaction with polyglutamine-expanded huntingtin alters cellular distribution and RNA processing of huntingtin yeast two-hybrid protein A (HYPA).
20829478 an atomic-resolution structure of an "invisible" folding intermediate of a small protein module: the FF domain; structure reveals non-native elements preventing formation of native conformation in the carboxyl-terminal part of the protein
17065151 FBP11 binding mechanism underlies the molecular pathology of severe neurological disorders, e.g., Rett syndrome and Huntington disease.
16391387 NAKAP-HypA scaffold is a potential nuclear docking site for huntingtin protein and may contribute to the nuclear accumulation of huntingtin observed in HD.
15456888 Results suggest an essential role of WW/FF domain-containing factors such as FBP11 and CA150 in pre-mRNA splicing that likely occurs in concert with transcription in vivo.
12381297 Data describe the structure of an FF domain from HYPA/FBP11, which differs from those of other phosphopeptide-binding domains and represents a novel phosphopeptide-binding fold.

AA Sequence

MRPGTGAERGGLMVSEMESHPPSQGPGDGERRLSGSSLCSGSWVSADGFLRRRPSMGHPGMHYAPMGMHP      1 - 70
MGQRANMPPVPHGMMPQMMPPMGGPPMGQMPGMMSSVMPGMMMSHMSQASMQPALPPGVNSMDVAAGTAS     71 - 140
GAKSMWTEHKSPDGRTYYYNTETKQSTWEKPDDLKTPAEQLLSKCPWKEYKSDSGKPYYYNSQTKESRWA    141 - 210
KPKELEDLEGYQNTIVAGSLITKSNLHAMIKAEESSKQEECTTTSTAPVPTTEIPTTMSTMAAAEAAAAV    211 - 280
VAAAAAAAAAAAAANANASTSASNTVSGTVPVVPEPEVTSIVATVVDNENTVTISTEEQAQLTSTPAIQD    281 - 350
QSVEVSSNTGEETSKQETVADFTPKKEEEESQPAKKTYTWNTKEEAKQAFKELLKEKRVPSNASWEQAMK    351 - 420
MIINDPRYSALAKLSEKKQAFNAYKVQTEKEEKEEARSKYKEAKESFQRFLENHEKMTSTTRYKKAEQMF    421 - 490
GEMEVWNAISERDRLEIYEDVLFFLSKKEKEQAKQLRKRNWEALKNILDNMANVTYSTTWSEAQQYLMDN    491 - 560
PTFAEDEELQNMDKEDALICFEEHIRALEKEEEEEKQKSLLRERRRQRKNRESFQIFLDELHEHGQLHSM    561 - 630
SSWMELYPTISSDIRFTNMLGQPGSTALDLFKFYVEDLKARYHDEKKIIKDILKDKGFVVEVNTTFEDFV    631 - 700
AIISSTKRSTTLDAGNIKLAFNSLLEKAEAREREREKEEARKMKRKESAFKSMLKQAAPPIELDAVWEDI    701 - 770
RERFVKEPAFEDITLESERKRIFKDFMHVLEHECQHHHSKNKKHSKKSKKHHRKRSRSRSGSDSDDDDSH    771 - 840
SKKKRQRSESRSASEHSSSAESERSYKKSKKHKKKSKKRRHKSDSPESDAEREKDKKEKDRESEKDRTRQ    841 - 910
RSESKHKSPKKKTGKDSGNWDTSGSELSEGELEKRRRTLLEQLDDDQ                           911 - 957
//

Text Mined References (42)

PMID Year Title
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22408419 2012 The effect of C-terminal helix on the stability of FF domain studied by molecular dynamics simulation.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21834987 2011 Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration.
21566141 2011 Interaction with polyglutamine-expanded huntingtin alters cellular distribution and RNA processing of huntingtin yeast two-hybrid protein A (HYPA).
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20829478 2010 A transient and low-populated protein-folding intermediate at atomic resolution.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17500595 2007 Huntingtin interacting proteins are genetic modifiers of neurodegeneration.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17161366 2006 Structural insights into the specific binding of huntingtin proline-rich region with the SH3 and WW domains.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17065151 2006 Structure of FBP11 WW1-PL ligand complex reveals the mechanism of proline-rich ligand recognition by group II/III WW domains.
16391387 2005 Interaction of the nuclear matrix protein NAKAP with HypA and huntingtin: implications for nuclear toxicity in Huntington's disease pathogenesis.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456888 2004 The WW domain-containing proteins interact with the early spliceosome and participate in pre-mRNA splicing in vivo.
15383276 2004 A protein interaction network links GIT1, an enhancer of huntingtin aggregation, to Huntington's disease.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12964049 2003 Identification and characterization of human FNBP3 gene in silico.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12460579 2002 Solution structure and ligand recognition of the WW domain pair of the yeast splicing factor Prp40.
12381297 2002 The structure of an FF domain from human HYPA/FBP11.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
9724750 1998 WW domain-mediated interactions reveal a spliceosome-associated protein that binds a third class of proline-rich motif: the proline glycine and methionine-rich motif.
9700202 1998 Huntingtin interacts with a family of WW domain proteins.
8605874 1996 Formin binding proteins bear WWP/WW domains that bind proline-rich peptides and functionally resemble SH3 domains.