Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.80
PubTator Score 2.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 1.16358221634674E-13
tuberculosis and treatment for 6 months 686 6.71420819951259E-7
osteosarcoma 7933 3.80742890007439E-5
ovarian cancer 8492 4.9589559031575E-4
Disease Target Count Z-score Confidence
Acne 20 4.021 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.442 0.000
tuberculosis and treatment for 6 months -1.100 0.000
non-small cell lung cancer -1.080 0.000
ovarian cancer -1.200 0.000

Synonym

Accession Q8NAV1 Q96JW1 Q9BVZ8
Symbols Prp38
PRP38A

Gene

PDB

4RZ9   4RZA  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA Inparanoid

Gene RIF (2)

PMID Text
26673105 Multiple protein-protein interactions are converging on the Prp38 protein during activation of the human spliceosome.
18854154 Knockdown of PRP38 pre-mRNA processing factor 38 domain containing A (PRPF38A) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1

AA Sequence

MANRTVKDAHSIHGTNPQYLVEKIIRTRIYESKYWKEECFGLTAELVVDKAMELRFVGGVYGGNIKPTPF      1 - 70
LCLTLKMLQIQPEKDIIVEFIKNEDFKYVRMLGALYMRLTGTAIDCYKYLEPLYNDYRKIKSQNRNGEFE     71 - 140
LMHVDEFIDELLHSERVCDIILPRLQKRYVLEEAEQLEPRVSALEEDMDDVESSEEEEEEDEKLERVPSP    141 - 210
DHRRRSYRDLDKPRRSPTLRYRRSRSRSPRRRSRSPKRRSPSPRRERHRSKSPRRHRSRSRDRRHRSRSK    211 - 280
SPGHHRSHRHRSHSKSPERSKKSHKKSRRGNE                                          281 - 312
//

Text Mined References (22)

PMID Year Title
26673105 2016 Multiple protein-protein interactions converging on the Prp38 protein during activation of the human spliceosome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...