Property Summary

NCBI Gene PubMed Count 49
PubMed Score 54.32
PubTator Score 351.19

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Retinitis pigmentosa 18 16 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count
Retinitis Pigmentosa 226

Expression

  Differential Expression (10)

Disease log2 FC p
dermatomyositis 1.300 6.8e-04
group 3 medulloblastoma 1.600 4.4e-04
intraductal papillary-mucinous adenoma (... 1.100 3.0e-03
intraductal papillary-mucinous carcinoma... 1.100 2.1e-03
malignant mesothelioma 1.300 1.1e-05
Multiple myeloma 1.098 1.5e-03
oligodendroglioma 1.700 8.5e-03
osteosarcoma -1.610 7.4e-04
ovarian cancer 2.600 1.3e-07
psoriasis -1.400 2.2e-04

Gene RIF (17)

AA Sequence

MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTLRFVDKLFEAV      1 - 70
EEGRSSRHSKSSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVEEEPEVIPGPPSESPGMLTKL     71 - 140
QIKQMMEAATRQIEERKKQLSFISPPTPQPKTPSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQ    141 - 210
ARIQAQLALKPGLIGNANMVGLANLHAMGIAPPKVELKDQTKPTPLILDEQGRTVDATGKEIELTHRMPT    211 - 280
LKANIRAVKREQFKQQLKEKPSEDMESNTFFDPRVSIAPSQRQRRTFKFHDKGKFEKIAQRLRTKAQLEK    281 - 350
LQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYIIPNGFDLTEENPKREDYFGITNLVEH    351 - 420
PAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISNLMRVLGTEAV    421 - 490
QDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKI    491 - 560
EANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKC    561 - 630
VLVWEGTAKDRSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLESTD                     631 - 683
//

Text Mined References (61)

PMID Year Title