Property Summary

NCBI Gene PubMed Count 44
PubMed Score 50.28
PubTator Score 59.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6685 3.8e-06
malignant mesothelioma 3163 1.3e-05
osteosarcoma 7933 3.8e-04
lung cancer 4473 6.8e-03

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.400 1.3e-05
psoriasis 3.600 3.8e-06
osteosarcoma 1.360 3.8e-04
lung cancer 1.100 6.8e-03

Gene RIF (22)

PMID Text
24731397 We report that PRP19 expression is elevated in lung carcinoma tissues compared to non-tumor tissues
24718257 These findings suggest that SKAP promotes ultraviolet rays-induced cell apoptosis by negatively regulating the anti-apoptotic protein Prp19.
24675077 involvement of hPso4 in the recombinational repair of DSBs
24598747 The Prp19-CDC5L complex plays a crucial role during human pre-mRNA splicing by catalytic activation of the spliceosome.
24587161 DNA damage induces down-regulation of Prp19 via impairing Prp19 stability in hepatocellular carcinoma cells.
24332808 PRP19 directly binds RPA and localizes to DNA damage sites via RPA, promoting RPA ubiquitylation in a DNA-damage-induced manner.
24069358 Prp19 complex as the first spliceosome subcomplex that directly contributes to mitosis in vertebrates independently of its function in interphase.
23220010 PRP19 over-expression is associated with hepatocellular carcinoma recurrence.
22967061 New insights into pre-mRNA processing factor 19
22529335 SNEV phosphorylation at S149 is essential for mediating the cytoprotective effect of SNEV upon DNA damage/oxidative stress and partially contributes to the life span extension caused by SNEV overexpression.
22174317 HIV-1 Rev interacting protein, pre-mRNA processing factor 19 homolog (PRPF19), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with PRPF19 is increased by RRE
21536736 U2AF65 binds directly to the phosphorylated C-terminal domain, and that this interaction results in increased recruitment of U2AF65 and PRP19C to the pre-mRNA
20416268 hPso4, once it forms a complex with Metnase, negatively regulates Metnase's TIR binding activity
20176811 Purified hPrp19/CDC5L complexes exhibit an elongated, asymmetric shape with a maximum dimension of approximately 20 nm.
19641227 Blom7alpha is a novel splicing factor of the K homology domain family that might be implicated in alternative splicing by helping to position the CDC5L-SNEV(Prp19-Pso4) complex at the splice sites [Blom7alpha]
18263876 hPso4 is necessary to bring Metnase to the DSB sites for its function(s) in DNA repair
17276391 ubiquitylated hPrp19 fails to interact with either Cdc5L or Plrg1 indicating that DNA damage can induce profound alterations to hPrp19 core complex.
16388800 The high levels of SNEV might extend the cellular life span by increasing the resistance to stress or by improving the DNA repair capacity of the cells.
16332694 SNEV, the human orthologue of yeast PRP19, functions in splicing and homo-oligomerization of SNEV in HeLa nuclear extract is essential for spliceosome assembly.
16223718 report the identification of two additional factors required in the DNA interstrand cross-links repair process, a previously characterized pre-mRNA splicing complex composed of Pso4/Prp19 and Werner syndrome protein(WRN)
15175653 required prior to catalytic step 1 of splicing, but not for stable integration of U4/U6.U5 tri-snRNPs
12960389 concluded that hPso4 plays a major and previously undefined role in mammalian DNA DSB repair[Pso4]

AA Sequence

MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATS      1 - 70
IPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGL     71 - 140
IVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQV    141 - 210
ASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVF    211 - 280
SASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSG    281 - 350
CSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWD    351 - 420
LRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFI    421 - 490
ASTGMDRSLKFYSL                                                            491 - 504
//

Text Mined References (50)

PMID Year Title
24731397 2014 PRP19 upregulation inhibits cell proliferation in lung adenocarcinomas by p21-mediated induction of cell cycle arrest.
24718257 2014 Small kinetochore associated protein (SKAP) promotes UV-induced cell apoptosis through negatively regulating pre-mRNA processing factor 19 (Prp19).
24675077 2014 The role of the human psoralen 4 (hPso4) protein complex in replication stress and homologous recombination.
24598747 2014 Structural insights into the novel ARM-repeat protein CTNNBL1 and its association with the hPrp19-CDC5L complex.
24587161 2014 DNA damage induces down-regulation of Prp19 via impairing Prp19 stability in hepatocellular carcinoma cells.
24332808 2014 PRP19 transforms into a sensor of RPA-ssDNA after DNA damage and drives ATR activation via a ubiquitin-mediated circuitry.
24069358 2013 The Prp19 complex directly functions in mitotic spindle assembly.
23220010 2013 Ubiquitin C-terminal Hydrolase 37, a novel predictor for hepatocellular carcinoma recurrence, promotes cell migration and invasion via interacting and deubiquitinating PRP19.
22967061 2012 New insights into pre-mRNA processing factor 19: A multi-faceted protein in humans.
22961380 2012 Human CWC22 escorts the helicase eIF4AIII to spliceosomes and promotes exon junction complex assembly.
22569250 2012 Tumor suppressor RBM5 directly interacts with the DExD/H-box protein DHX15 and stimulates its helicase activity.
22529335 2012 ATM-dependent phosphorylation of SNEVhPrp19/hPso4 is involved in extending cellular life span and suppression of apoptosis.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21536736 2011 The RNA polymerase II C-terminal domain promotes splicing activation through recruitment of a U2AF65-Prp19 complex.
21269460 2011 Initial characterization of the human central proteome.
20595234 2010 The Prp19 complex and the Usp4Sart3 deubiquitinating enzyme control reversible ubiquitination at the spliceosome.
20467437 2010 Direct interaction between hnRNP-M and CDC5L/PLRG1 proteins affects alternative splice site choice.
20416268 2010 Regulation of Metnase's TIR binding activity by its binding partner, Pso4.
20176811 2010 Molecular architecture of the human Prp19/CDC5L complex.
19946888 2010 Defining the membrane proteome of NK cells.
19641227 2009 Blom7alpha is a novel heterogeneous nuclear ribonucleoprotein K homology domain protein involved in pre-mRNA splicing that interacts with SNEVPrp19-Pso4.
19633697 2009 Cdc5L interacts with ATR and is required for the S-phase cell-cycle checkpoint.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19188445 2009 APE1/Ref-1 interacts with NPM1 within nucleoli and plays a role in the rRNA quality control process.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18263876 2008 Human Pso4 is a metnase (SETMAR)-binding partner that regulates metnase function in DNA repair.
17981804 2008 Isolation of XAB2 complex involved in pre-mRNA splicing, transcription, and transcription-coupled repair.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17349974 2007 Mouse homologue of yeast Prp19 interacts with mouse SUG1, the regulatory subunit of 26S proteasome.
17283042 2007 Early embryonic lethality of mice lacking the essential protein SNEV.
17276391 2007 The Prp19/Pso4 core complex undergoes ubiquitylation and structural alterations in response to DNA damage.
16388800 2006 SNEV overexpression extends the life span of human endothelial cells.
16332694 2005 SNEV is an evolutionarily conserved splicing factor whose oligomerization is necessary for spliceosome assembly.
16223718 2005 The Pso4 mRNA splicing and DNA repair complex interacts with WRN for processing of DNA interstrand cross-links.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15660529 2005 Interaction of U-box E3 ligase SNEV with PSMB4, the beta7 subunit of the 20 S proteasome.
15635413 2005 Nucleolar proteome dynamics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15175653 2004 A subset of human 35S U5 proteins, including Prp19, function prior to catalytic step 1 of splicing.
12960389 2003 Role of human Pso4 in mammalian DNA repair and association with terminal deoxynucleotidyl transferase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12429849 2002 Functional proteomic analysis of human nucleolus.
11991638 2002 Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.
11790298 2002 Directed proteomic analysis of the human nucleolus.
11435423 2001 U box proteins as a new family of ubiquitin-protein ligases.
11082287 2000 hNMP 200: a novel human common nuclear matrix protein combining structural and regulatory functions.
10404385 1999 Reassembling proteins and chaperones in human nuclear matrix protein fractions.