Property Summary

NCBI Gene PubMed Count 418
PubMed Score 1922.48
PubTator Score 1503.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Dental caries 67 0.0 1.0
Disease Target Count Z-score Confidence
Macular degeneration 44 0.0 4.0

Expression

  Differential Expression (22)

Disease log2 FC p
glioblastoma 2.200 1.5e-03
malignant mesothelioma 1.900 2.9e-06
Barrett's esophagus 2.500 2.5e-02
esophageal adenocarcinoma 2.200 2.7e-02
psoriasis -2.200 7.2e-04
osteosarcoma -4.003 7.1e-04
posterior fossa group B ependymoma 3.200 2.7e-11
intraductal papillary-mucinous adenoma (... 2.000 3.4e-03
intraductal papillary-mucinous neoplasm ... 2.600 6.6e-03
lung cancer 5.500 1.8e-06
pancreatic cancer 1.500 7.5e-03
breast carcinoma -1.700 4.5e-10
interstitial cystitis -3.300 1.2e-04
lung adenocarcinoma 1.300 6.1e-03
adult high grade glioma 1.800 8.7e-03
invasive ductal carcinoma -1.934 3.3e-02
nasopharyngeal carcinoma -2.900 9.2e-04
Breast cancer -4.100 8.2e-08
mucosa-associated lymphoid tissue lympho... -1.269 4.0e-02
acute myeloid leukemia -2.100 3.9e-02
ulcerative colitis -1.200 3.5e-02
ovarian cancer 2.200 6.3e-03

Gene RIF (383)

PMID Text
26898076 CD133 expression was mainly seen in the apical/endoluminal cell surface of ovarian serous carcinoma cells and was found in 61% of the carcinoma samples and 41% of the peritoneal metastases.
26758620 CD133(+) Hepatocellular carcinoma cancer stem cell resisted IFN-g-induced autophagy, which might also be a mechanism through which cancer stem cell resist immune eradication.
26722393 meta-analysis results suggest that CD133 is an efficient prognostic factor in pancreatic ductal adenocarcinoma
26702251 A novel and unique intronic mutation of PROM1, underlying autosomal recessive cone-rod dystrophy in a consanguineous Israeli family, was found.
26690524 Overexpression of CD133 mRNA and BMI1 protein was found in 47.6 and 76.2% patients respectively.
26625750 Detecting the expression of CD133 and ALDH1 in invasive ductal breast carcinomas may be of help in more accurately predicting the aggressive properties and determining the optimal treatment.
26608413 CD44 and CD133 might participate in early-stage endometrial cancer carcinogenesis
26539911 Results suggest that p53-mediated transcriptional regulation of CD133 is a key underlying mechanism for controlling the growth and tumor-initiating capacity of CSCs.
26530530 Results show that CD133 expression was increased in the pancreatic ductal adenocarcinoma tissues and inversely correlated with LXN expression.
26515729 High CD133 expression is associated with cancer.
26511095 In conclusion, we provided the first proof of the existence of G4 structures within the CD133 gene that can be pharmacologically targeted to impair Cancer Stem Cells aggressiveness
26503471 Studies indicate that overexpression of CD133 protein is associated with lymph node metastasis, distant metastasis, poor TNM stage.
26442717 CD133 expression is a useful biomarker for prediction of colorectal cancer progression and survival of patients.
26406410 CD133 polymorphisms are associated with poor response to bevacizumab in patients with metastatic colorectal cancer.
26403404 results suggest that gingival CD133 expression could be a predictive marker of favourable periodontal healing.
26370320 The Ultrasound-targeted microbubble destruction technique targeted for CD133 downregulation may be examined as a potential therapeutic strategy for Hepatocellular carcinoma .
26298632 Basal like tumors are enriched for cancer stem cells (CSC) with CD44(+)/CD24(-/low) phenotype. CD133 can detect a different population of CSC in breast carcinoma
26293462 Living close to a major roadway is associated with elevated levels of circulating cells positive for the early stem marker AC133(+).
26261540 High levels of PROM1 membrane expression and combination of membrane/cytoplasm expression were associated with adverse prognosis in non-small cell lung cancer.
26191258 CTAs (MAGE-A4, NY-ESO-1, MAGE-A10) were more likely expressed in patients with squamous cell carcinoma of the lung and when CTAs combined with CD133, they can be better prognostic factors.
26183533 study dissects nucleolin-mediated activation of surface AC133 and its cognate gene CD133, via specific interaction of nucleolin with the tissue-dependent CD133 promoter P1
26176038 The elevated expression of EpCAM and/or CD133 is closely related to the carcinogenesis, progression, clinical biological behaviors, and prognosis of gallbladder adenocarcinoma.
26153215 This is the first report of a deep intronic variant that acts as a splicing mutation in PROM1.
26141860 microenvironment stimuli eliciting epithelial-to-mesenchymal transition are able to increase the dissemination potential of lung cancer cells through the generation of the CD133(+)/CXCR4(+)/EpCAM(-) subset.
26110599 Both ELOVL4- and PROM1-related maculopathies are characterized by progressive photoreceptor atrophy and central vision loss. Using advanced diagnostic imaging, early disease changes and disease progression can be characterized.
26095609 Our results suggest that ANXA3 can serve as a novel diagnostic biomarker and that the inhibition of ANXA3 may be a viable therapeutic option for the treatment of CD133+ liver-CSC-driven HCC.
26092504 Esophageal squamous cell carcinoma cells coexpressing CD133 and CXCR4 possess the characteristics of cancer stem cells.
26081615 It was found that CD133(+) cells existed in primary human laryngeal tumor with enhanced capacity of proliferation and invasion. Bmi-1, implicated in self-renewal and tumorigenesis, was coexpressed with the CD133.
26068177 CD133 cancer stem marker expression correlates with liver metastases in colorectal cancer patients.
26046383 Results show that over-expression of both ALDH1 and CD133 were only found in non small cell carcinoma and adenocarcinoma (ADC) types of lung neoplasm but only, the low expression of ALDH1 was associated with more aggressive tumor in ADC patients.
26029999 Results identified the characteristics and function of CD133 glycosylation sites. These data could potentially shed light on molecular regulation of CD133 by glycosylation.
26020117 in human ovarian cancer cells CXCR4 and CD133 expression identified a discrete population with stem cell properties that regulated tumor development and chemo resistance
26002465 Survivin expression and chemoresistance were increased in CD133+ colon cancer cells.
25967234 High level of CD133 expression trends to correlate with a worse OS and PFS in glioma patients, especially WHO IV gliomas
25921286 CD133 overexpression is significantly associated with clinicopathological factors and poorer survival outcome.
25862862 CD133 expression and THBS1 expression were prognostic factors, and a negative relationship between HDAC and THBS1 was observed in advanced gastric cancer.
25840983 our data demonstrate the high activity of this new bsAb against patient-derived AC133-positive (CD133)GBM-SCs in models of local therapy of highly invasive glioblastoma multiforme .
25829252 Study showed that CD133 expression contributes to pancreatic cancer "stemness," tumorigenicity, EMT induction, invasion, and metastasis.
25823028 CD133 and DNA-PK regulate MDR1 via the PI3K- or Akt-NF-kappaB pathway in multidrug-resistant glioblastoma cells.
25788271 In the presence of CD133+ ovarian CSLCs, CD133- non-CSLCs can undergo an epithelial-mesenchymal transition (EMT)-like process and display enhanced metastatic capacity.
25783528 antagomir-1290 significantly inhibited the proliferation, clonogenicity, invasion, and migration of CD133(+) cells by targeting fyn-related Src family tyrosine kinase.
25735334 CXCR4 and CD133 co-expression was associated with lymphatic metastasis in stage II~III colon cancer.
25727099 Higher percentages of CD133/ ABCG2 expressing cells were identified in blood samples from gastric cancer patients compared to normal controls.
25724578 CD133 antigen was found to be a tumor marker in primary myelofibrosis.
25710579 Prognostic Significance of CD44v6, CD133, CD166, and ALDH1 Expression in Small Intestinal Adenocarcinoma.
25625240 Results show that CD44 and CD133 mRNA were highly co-expressed in colorectal cancer with hepatic metastases and that CD44 expression was an independent factor associated with patient survival.
25605013 Suggest that galectin-1 plays a major role on the tumorigenesis and invasiveness of CD133+ lung adenocarcinoma cells.
25589004 This meta-analysis shows that CD133 expression is correlated with higher grade of gliomas and worse prognosis for glioma patients.
25551472 Lxn protein and mRNA expression levels in CD133+ miapaca-2 cells were significantly lower than those in CD133- cells.
25487874 Findings indicate that Cell-surface Vimentin csVimentin(+) CD133(-) cells are promising targets for treatment and prevention of metastatic hepatocellular carcinoma.
25449786 The resistance of CD133(+) melanoma subpopulation is attributed to the enhanced drug efflux mediated by ATP-binding cassette sub-family B member 5 (ABCB5), since the knockdown of ABCB5 was found to sensitize CD133(+) cells to CAPE.
25436343 CD133 expression is correlated with poor prognosis in resected colorectal cancer.
25433813 Our data suggests that absence of expression of CD133 can be a useful marker in the differential diagnosis between malignant papillary lesions and their benign or atypical mimics.
25426558 glioblastoma stem cells are killed by CD133-specific CAR T cells but induce the T cell aging marker CD57
25339008 High CD133 expression is associated with gastric cancer.
25339000 Elevated expression levels of CD133 in the melanomas are associated with advanced disease, with more aggressive and metastatic skin tumors
25331798 Data suggest that CD133(+) CRC stem cells have a distinct expression pattern and that survivin, up-regulated by differentially expressed IL-4, is a candidate biomarker for the prediction of recurrence and survival in CRC.
25311946 Our findings suggest that mir-152 inhibits cell proliferation and colony formation of CD133(+) hep3B cells by targeting KIT.
25301737 Increased expression of CD133 was associated with hepatocellular carcinoma.
25269803 CD133-positive hematopoietic progenitor cells initiate growth and metastasis of colorectal cancer.
25256670 the high expression of CRTC2 and PROM1 may play an important role in the occurrence and hereditary, and also advance the potential pathways that integrate genetic variants in the development of NSCLC.
25230779 CD133 may inhibit 5-FU-induced apoptosis by regulating the expression of P-gp and Bcl-2 family mediated by phosphoinositide 3-kinase/Akt/p70S6K pathway in gastric cancer cells.
25184684 These findings support PROM1 as a tumor cell-intrinsic marker related to glioblastoma survival, independent of its stem cell properties, and highlight potentially divergent roles for this protein in normal mouse and human glia.
25168019 CD133, CD44, and CD90 could be used as prognostic and predictive markers in hepatoblastoma.
25120750 CD133 was not an independent prognostic factor in glioma patients
25082219 Use magnetic sorting to enrich embryonic stem cells for the cell surface marker CD133, increasing the expansion rate and neuronal fate specification.
25015418 miR-142-3p directly targets CD133 to regulate its ability to confer cancer and stem cell-like features in HCC.
25010141 We suggest a hypothetical model whereby CD133 promotes morphogenesis in early hair follicle placodes through the localized removal of membrane beta-catenin proteins and subsequent adherens junction dissolution.
24962344 N-cadherin and CD133 expressions are strongly correlated and N-cadherin appears as a potential breast cancer metastases marker in a specific patient subpopulation.
24940615 High level of CD133 expression tends to correlate with a worse prognosis and a higher rate of lymph node metastasis in non-small-cell lung cancer patients. (Meta-analysis)
24920554 Results suggest that overexpression of CD133, CD44v6 and TF is associated with pancreatic carcinoma metastasis.
24911657 the biochemistry and trafficking of prominin-1 in salivary gland tumors and inflammatory diseases
24864242 The goal of this study was to semiquantitatively detect presence of cancer stem cells markers CD44 and CD133 in immunohistochemically stained paired samples of colorectal cancer (CRC) and colorectal liver metastases.
24839953 High CD44/CD133 expression is an independent prognostic factor for disease-free survival in pancreatic ductal adenocarcinoma.
24804195 Expressions of ABCG2, CD133, and podoplanin in salivary adenoid cystic carcinoma.
24798639 Expansion of collagen-producing PROM1 positive cells within regions of periportal fibrosis is associated with activated fibroblast growth factor (FGF) and transforming growth factor(TGF)-beta pathways in biliary atresia.
24763286 Compound heterozygous mutations in PROM1 gene could cause cone-rod dystrophy.
24758564 High CD133 expression is associated with laryngeal squamous cell carcinoma.
24727449 this study reports the first analysis and comparison of the expression patterns and colocalization of DDX4 and CD133 in 59 ovarian cancer patients via tissue microarray and immunofluorescence analysis to identify the expression patterns and relationship of those two markers in ovarian cancer cells.
24630518 Coexpression of B7-H3 and CD133 is associated with depth of tumor invasion, lymphatic metastasis, and distant metastasis of colorectal cancer
24586330 Stem Cell quantification defined by CD133 and NANOG expression has no correlation with relapse-free-survival or overall survival in this cohort of Stage II colon cancer.
24556617 Lysine acetylation on predicted extracellular residues plays a key role in expression and trafficking of CD133 protein to the cell surface and can be targeted to disrupt CD133 regulation and function.
24547909 In this report, we highlight that pediatric cone-rod dystrophy with high myopia and nystagmus suggests recessive mutations in the gene PROM1.
24511670 It is the first identified member of the prominin family of pentaspan membrane proteins and is a marker of hepatic stem cells.
24484648 The data from the current study demonstrated novel PROM1 and CRTC2 mutations, which could promote lung cancer development
24468059 CD133 plays a critical role in facilitating the epithelial-mesenchymal transition regulatory loop leading to the invasion and metastasis of pancreatic cancer cells
24467938 CD133+ renal stem cells always co-express CD24 in adult human kidney.
24449656 The objective of this research was to evaluate the partition behavior of CD133(+) in ATPS in route to establish the basis for the development of a novel and scalable purification bioprocess
24436149 CD133 expression was increased in mouse and human SCLC.
24366104 These findings demonstrate that increased chemoresistance and tumorigenic potential of CD133+ cells are at least partly attributed to an enriched SP fraction as well as increased MMP-1 expression.
24335569 The level of CD34+CD133+ endothelial progenitor cells probably serves as a predictor of the development and severity of atherosclerosis on a cellular level.
24330829 high expression of CD133 in triple-negative breast cancer (TNBC)-derived cells correlates with high invasive potential; aggressive properties of CD133high cells are mitigated by PLC-beta2 which down-modulates expression of CD133 and may play a role in preventing metastatic progression of CD133 positive TNBC
24302553 These findings suggest that these two CD133 miRNA binding site variants, rs2240688 and rs3130, may be potential biomarkers for genetic susceptibility to gastric cancer and possible predictors for survival in gastric cancer patients.
24300467 CD133 displays higher expression in recurrent than in primary ovarian neoplasms
24299311 we first reported that A549 CD133+ cells exhibited characteristic of high liver metastatic potential which makes it be a suitable model for further study of liver metastasis of lung adenocarcinoma
24228135 CD133-positive non-small cell lung cancer patients had worse prognosis, and was associated with common clinicopathological poor prognostic factors.
24146103 Glut-1 is important in the energy supply of laryngeal CD133+ Hep-2 cells.
24129546 High CD133 expression is associated with glioblastomas.
24102054 These observations indicate that CD133 is a specific marker of glandular differentiation that could be included in the diagnostic panel of cutaneous tumors with possible eccrine or apocrine differentiation
24054866 Data show that the average CD133 mRNA in patients with metastatic clear cell renal cell carcinoma (cRCC) was significantly higher than that in those with localized cRCC or in controls.
24008862 High CD133 expression is associated with carcinogenesis of lung cancer.
23991844 CD133-positive glioma stem cells could survive, change to a proliferative cancer stem cell phenotype, and cause recurrence in cases with de novo glioblastomas after radiotherapy and chemotherapy.
23962788 CD133 expression was increased in endometrial cancer stem cells following increases in androgen receptor expression.
23917144 CD133 and Oct3/4 in cholangiocarcinoma are associated with increased formation of DNA lesions and the DDR protein, which may be involved in genetic instability and lead to cholangiocarcinoma development with aggressive clinical features.
23861881 miR-1915 and miR-1225-5p regulated the expression of important markers of renal progenitors, such as CD133 and PAX2, and important genes involved in the repair mechanisms of adult renal progenitor cells, such as TLR2.
23851436 Data indicate that forty-eight (58%) of 83 patients with pancreatic cancer positively expressed S100A4, and 50 (60%) and 29 (36%) patients positively expressed TP53 and CD133, respectively.
23840432 HIF-1alpha and HIF-2alpha activate CD133 promoter through ETS proteins.
23777983 Our results show CD133(+) and CD133(+)CXCR4(+) cancer cells correlate with the presence of lymph node metastasis in colorectal cancer.
23734191 Data indicate there is a negative correlation between the genetic signature of epithelial-to-mesenchymal transition (EMT) and that of CD133 cell surface protein.
23715500 A microRNA-135a/b binding polymorphism in CD133 confers decreased risk and favorable prognosis of lung cancer in Chinese by reducing CD133 expression.
23708735 CD133+ cells showed a high proliferation rate.
23701640 HGF and SDF-1 are required for effective mobilization and homing of CD133+ hematopoietic stem cells to the liver after hepatic resection.
23661576 The potential role of CD133 as a promising marker of chemoresistance in nonluminal BC patients.
23658323 This report shows a correlation between the expression of CD133 and glioblastoma recurrence.
23619912 MiR-142-3p functions as a tumor suppressor by targeting CD133, ABCG2, and Lgr5 in colon cancer cells
23615455 CD133 is expressed in poorly-differentiated neuroendocrine carcinomas and well-differentiated neuroendocrine tumors of the digestive tract.
23609373 Found that high expression of CD44 and CD133 were closely associated with malignant phenotypic features and/or poor prognosis of gastric cancer patients.
23604326 Our results showed that CD133 can serve as a specific surface marker for nasopharyngeal cancer stem cells.
23593389 GPR87 promotes the growth and metastasis of CD133(+) cancer stem-like cells, and our findings may reveal new targets for HCC prevention or therapy
23584268 The surface glycoprotein CD133 is an independent prognostic marker of survival and its positive expression indicates increased chemotherapy resistance.
23569237 Activation of PI3K/Akt pathway by CD133-p85 interaction promotes tumorigenic capacity of glioma stem cells.
23558457 Gastric cancer cells with CD133 expression in the cytoplasm were cells with high potential for malignancy, and this phenotype was associated with cancer progression, chemotherapy resistance, recurrence, and poor prognosis.
23545719 the expression and localisation of the proteins, osteopontin (OPN) and prominin-1 (CD133), as well as the plasma OPN levels in the endometrium of patients with endometriosis, were investigated.
23533603 CD133-positive gastric cancer patients had worse prognosis, and was associated with common clinicopathological poor prognostic factors.
23532815 CD133 expression is highly associated with poor prognosis in acute leukemic patients.
23495873 CD133, a stem cell marker in mice: results in animal models cannot always be applied to human skin.
23448401 Low CD133 expression is associated with esophageal squamous cell carcinoma.
23438193 Positive correlation of Oct4 and ABCG2 to chemotherapeutic resistance in CD90(+)CD133(+) liver cancer stem cells.
23437259 CD133 is involved in cell survival through regulation of autophagy and glucose uptake, which may be necessary for cancer stem cells to survive in tumor microenvironment.
23409180 CD133 is an efficient prognostic factor in colorectal cancer
23408993 CD133 mRNA expression levels in GIST patients measured by real time RT-PCR assay appeared to correlate with tumor response to surgery or imatinib and may be used to predict tumor progression
23396254 A gradual and inversely proportional correlation between CD133 expression in head and neck tumours and decreased overall survival was observed, along with a positive correlation with the presence of lymph node metastases.
23340741 hypoxia promotes glycosylation status of CD133, indicating possible involvement of glycosylated CD133 in the process of anti-hypoxia-mediated apoptosis.
23326490 CD133 interacts with plakoglobin and knockdown of CD133 by RNA interference (RNAi) results in the downregulation of desmoglein-2.
23322518 Our data suggest that AC133 is an independent adverse prognostic factor and a potential marker for survival classification in stage II colorectal cancer patients
23318676 Down-regulation of CD133 in malignant melanoma cells impaired substrate and inter-cellular adhesion, cell motility and invasion. Prominin-1 also mediates Wnt activation.
23276935 CD133+ cancer stem cells are closely related with the metastasis of lung cancer, especially lymphoid metastasis, and resistance of several chemotherapeutic drugs, CD133 can have an important prognostic impact in patients with lung cancer[review]
23252868 levels of CD133, CD44, and ALDH1 had independent prognostic value to predict the recurrence of lung adenocarcinoma
23245659 The prognostic significance of the CD133 antigen and promoter methylation and protein expression of MGMT in a homogenous group of glioblastoma patients uniformly treated with radiotherapy and temozolomide.
23233126 HepG2-CD133+ cells possess higher capacity for tumorigenicity.
23216926 Overexpression of CD133 was highly correlated with reduced overall survival.
23216238 Increased cell nucleus atypia, rougher endoplasmic reticulum, and more microvilli were observed in CD133-positive U251 glioma stem cells.
23206244 repair signaling in CD133 + UCBC is different from CD133 - umbilical cord blood cells
23195431 CD133 affects the invasive ability of HCT116 cells by regulating TIMP-2.
23170850 Data indicate that the vasculogenic mimicry (VM) and expression of CD133 were significantly higher in carcinoma than in normal.
23150174 CD133 induces tumour-initiating properties in HEK293 cells in vivo and is potentially involved in the regulation of tumourigenicity
23150059 findings support the notion that prominin-1 plays an active role in cell growth through its ability to interact and potentiate the anti-apoptotic and pro-angiogenic activities of VEGF
23138940 CD133(pos) prostate cells proliferate faster than CD133(neg) cells.
23106300 This article reviews the complex regulation of CD133 and its extracellular epitope AC133, and associated alterations, to tumour cell behaviour by hypoxia.[review]
23084749 The role of CD133 in beta-catenin signaling is through the recruitment of HDAC6 to deacetylate beta-catenin for its stabilization and nuclear localization.
23071857 CD133 expression is upregulated in pancreatic ductal adenocarcinoma.
23065858 Low expression of CD133 is associated with microsatellite instability in colorectal cancer.
23055022 Tbeta4 expression was also co-localized with CD133 expression in primary ovarian carcinomas.
23049880 CD133 is a useful surrogate marker for predicting chemosensitivity to neoadjuvant chemotherapy in breast cancer
23045288 the CD49f(-)CD133(+) phenotype appears to identify OSIC-like cells that possess strong tumorigenicity correlated with an impaired osteogenic fate.
22964855 expression shows high plasticity in colorectal carcinoma cell lines
22964035 Loss of alpha-dystroglycan and increased CD133 expression are frequent events in human colon cancer and evaluation of CD133 expression could help to identify high-risk colon cancer patients
22960282 Human Prominin1 is not only capable of rescuing the corresponding rhabdomeric Drosophila prominin mutation but also demonstrates a conserved genetic interaction with a second photoreceptor protein Eyes Shut.
22945648 results demonstrate that Sp1 and Myc regulate CD133 transcription in glioma stem cells and promoter methylation and methyl-DNA-binding proteins cause repression of CD133 by excluding transcription-factor binding
22944295 the expression of stem cell marker cd133 may serve as a favorable prognostic marker in papillary renal cell carcinoma.
22922842 Clonal dominance of CD133+ subset population as risk factor in tumor progression and disease recurrence of human cutaneous melanoma.
22871210 Flow cytometry analysis was performed to detect distinct subsets with CD133 and CXCR4 markers in human primary and metastatic CRC tissues. In human specimens, CD133(+)CXCR4(+) cells were higher in liver metastases than in primary colorectal tumors.
22865455 Data show that CD133(+) and ABCB5(+) subpopulations are colocalized in melanomas in perivascular niches that contain CD144 (VE-cadherin)(+) melanoma cells forming vessel-like channels, a phenomenon termed vasculogenic mimicry (VM).
22842095 Studies indicate that CD44 and CD133 as cancer stem cell markers in head and neck squamous cell carcinomas.
22830353 CD133, as a putative stem cell marker, is associated with more advanced stages of Wilms and neuroblastoma tumors.
22782852 the expression of cancer stem cell markers ALDH1 and CD133 correlate with a high risk of malignant transformation in a large series of patients with premalignant oral leukoplakia
22748652 In this article, the authors discuss the complex regulation of CD133 expression in gliomas, its role in tumorigenesis, and its potential as a marker for targeted and personalized therapeutic intervention. [Review Article]
22740326 The data demonstrated that metastatic properties of cell populations from blood and liver metastasis, differently from primitive tumors, seem to be strictly related to the phenotype CD133 positive and CD44 positive.
22739150 There is no statistical correlation between expression of CD133 and CD34 in childhood B-linage acute lymphoblastic leukemia. The expression of CD133-2 is significantly related to the level of minimal residual disease.
22668828 Studies suggest cancer stem cells CD133 and isocitrate dehydrogenase (IDH) mutation could be prognostic factors in glioblastoma.
22664874 The number of tumor-assocoiated microglia/macrophages at the invasive cell front correlates with the presence of CD133-positive glioma stem-like cells, which produce high levels of TGF-beta1.
22652175 Suggest the presence of a distinct subpopulation of CD133(+) cells isolated from human brain tumors, with characteristics of endothelial progenitor cells.
22623141 Protein extracts of colon cancer CD133+ cell stem cells were compared to protein extracts of colon cancer cell CD133- stem cells by 2D DIGE. Demonstrated a direct cause-effect relationship between Wnt pathway activation & increased SRp20 expression.
22614155 The expression of nuclear HIF-1alpha was correlated with CD133.
22571340 CD133 negatively regulates tumorigenicity via AKT pathway in synovial sarcoma.
22529031 Stem cell marker,CD133 expression was detected in most human melanoma cells, which suggests the presence of cells with tumor-initiating potential in this cell line.
22514116 Our results show that CD133high ncells have tumor-initiating cell properties and present different genotyping characteristics compared to CD133low cells.
22496204 CD133 expression is upregulated in colorectal tumors that have a hyperactivated Ras-Raf-MEK-ERK pathway and is related to mutations in K-Ras or B-Raf
22453233 CD133 after chemoradiotherapy (CRT) is a significant prognostic factor in rectal cancer patients treated with preoperative chemoradiotherapy and surgical resection.
22448662 CD133 expression is similar in three types of ovarian malignant germ cell tumors and thus is not diagnostically useful.
22431923 CD133 positive cells are relatively radioresistant under intracerebral growth conditions
22408058 CD133 expression may denote a subset of rhabdomyosarcoma(RMS) cells with an important role in tumorigenesis and treatment failure.
22395973 Low PROM1 gene expression is assiciated with glioblastoma multiforme.
22395309 The expressions of the cancer stem cell markers ABCB1, ABCG2, and CD133 increased with increases in the degree of differentiation in the human gastric adenocarcinomas.
22394107 There was a significant association between CD133 expression and the following poor prognosis covariates: age, International Neuroblastoma Staging System stage, MYCN amplification, and phospho-AKT expression.
22337994 our findings show AF4-dependent regulation of CD133 expression, which is required for the growth of acute lymphoblastic leukemia cells
22322379 The epithelial-mesenchymal transition (EMT) correlated with CD24+CD44+ and CD133+ cells in pancreatic cancer.
22315171 The expression of CD133 may be inversely correlated with the expression of FHIT.
22246536 The combination of intrathecal transplantation of CD133 cells and application of a magnetic field at the site of injury is a possible therapeutic strategy to treat rat spinal cord injury.
22246526 Expression of CD133 was independently correlated with the histological tumor regression grade (P<0.01).
22236447 This is the first time to report the presence of CD133-positive cancer cells in esophageal squamous cell carcinoma (ESCC) but not supporting its prognostic value and validity as a CSC marker for ESCC.
22231565 These results suggest that CD133 is a predictive marker for standard first-line BV-based treatment in mCRC.
22199321 cancer stem cell antigens CD133, BCRP1/ABCG2 and CD117/c-KIT are not associated with prognosis in resected early-stage non-small cell lung cancer
22178090 Both CD133-positive and nestin-positive blood vessels have an important role in maintaining the structure of the glioma stem cell niche.
22157717 enhanced tumorigenic potential of CD133+, compared with CD133-, colorectal cancer cells is due to their increased ability to interact with their neighboring carcinoma-associated fibroblasts
22156015 The co-expression of CD133 and nestin as well as results of the functional assays suggest a possible presence of cancer cells with a stem-like phenotype in rhabdomyosarcoma.
22140506 CD133/Src signaling is a regulatory switch to gain of epithelial-mesenchymal transition and of stemness properties in head and neck squamous cell carcinoma.
22130902 Increased expression of CD44, CD166 and CD133 from normal mucosa samples to adenoma and carcinoma was linked to tumor progression in tumors of the ampulla of Vater.
22130040 The increased amount of membrane particle-associated CD133 in the CSF of patients with partial epilepsy contributes to the debate of the source of these particles emerging from subventricular zone astrocytes serving as neural stem cells.
22123613 Both CD133 antigen-positive dendritic cells (DC) and CD133-negative hybrid DC can cause significant T cell immune responses in vitro.
22119814 CD44 has limited utility in identifying oral cancer stem cells, while CD117 and CD133 expression appears to be limited more in identifying mesenchymal stem cells.
22079466 CD133-expressing liver cancer cells following radiation exposure showed higher activation of MAPK/PI3K signaling pathway and reduction in reactive oxygen species levels compared to CD133- cells
22076958 Our results show that CD133 and CD44 are universally expressed in gastrointestinal stromal tumors, and may represent a lineage rather than a cancer stem cell marker
22072879 Investigated expression of CD44 and CD133 in four different cancer cell lines (glioblastoma, melanoma, pancreatic, prostate adenocarcinoma). Only the melanoma cells were positive to both markers of CD44 and CD133; the other cells were only CD44-positive.
22049795 Inflammation can up-regulate the expressions of Integrin alpha2beta1 and CD133 in benign prostatic hyperplasia tissue.
22025269 Overexpression of miR-150 lead to a significant reduction of CD133+ cells.
22008114 Studies suggest that the use of CD133 expression as a marker for cancer stem cells research should be critically evaluated in each experimental system.
21994122 CD133(+) liver tumor-initiating cells promote tumor angiogenesis, growth, and self-renewal through neurotensin/interleukin-8/CXCL1 signaling.
21966538 Data show the importance of the stem cell marker prominin-1/CD133 in the uptake of transferrin and in iron metabolism in human colon cancer Caco-2 cells.
21959795 Mahlavu cells exhibited strong gefitinib resistance and the CD133 expression level was dramatically increased (from 3.88% to 32%) after drug treatment.
21947321 In the hypoxic conditions, OCT4 and SOX2, both of which are induced by HIF1alpha/HIF2alpha. promote CD133 expression in the lung cancer cells via their direct interaction with the P1 promoter.
21937449 study identifies a set of genes involved in CD133 N-glycosylation as a direct contributing factor to cell surface AC133 recognition and provides biochemical evidence for the function and structure of CD133 N-glycans
21931765 MiR-34a targeting of Notch ligand delta-like 1 impairs CD15+/CD133+ tumor-propagating cells and supports neural differentiation in medulloblastoma
21917149 although CD133 is expressed only in a small population of hTERT-immortalized prostate cancer cells, it is not likely to be associated with stem cells, as CD133- and CD133+ cells exhibited similar tumorigenicity
21912092 Expression of CD133 in pituitary adenomas is related to immature endothelial progenitor cells that may play a role in the neovascularization of pituitary adenomas.
21901757 The AC133 epitope, rather than CD133 mRNA or protein, mirrors malignancy-related tumor traits such as tumor differentiation and local oxygen tension levels.
21900452 Oct4A levels and differentiation potential of papillary CD133(+) cells were higher than those of CD133(+) cells from cortical tubuli. Hypoxia was able to promote the undifferentiated phenotype of CD133(+) progenitors from papilla
21898409 Although CD133(+) and CD133(+)/CD44(+) were detectable in human primary gastric cancers, they neither expressed stem-like properties nor exhibited tumor-initiating properties in xenograft transplantation experiments.
21868340 The expressions of Oct4 and CD133 are upregulated in colonic cancer compared with those in the adjacent tissues and show a positive correlation.
21829201 CD44 and Musashi-1 are frequently expressed in both premalignant gastric lesions and invasive gastric cancer, whereas CD133 expression is restricted mainly to neoplastic tissues.
21826669 we have identified a molecular signature associated with potential cancer stem cells and showed for the first time the existence of a functional relationship between CD133, endothelin-1 and NR4A2 expression in colon cancer cells.
21808992 Data suggest that arterial dysfunction found in patients with beta-thalassaemia major before and after HSCT may be related to impaired proliferation of CD133(+)VEGFR2(+) and CD34(+)VEGFR2(+) cells.
21801380 CD133 expression is not altered in prostate cancer and it is consistent with an important role for CD133 in the maintenance of the hierarchical cell differentiation patterns in cancer.
21798073 Data show that CD133 expression correlates with the differentiation of CC and indicates that CD133 is a potential indicator for differentiation and prognosis of CC.
21778785 Compared with normoxia, hypoxia elevated the expression of CD133, CXCR4 and HIF-1alpha. Moreover, hypoxia facilitated the invasiveness of CD133+ pancreatic cancer cells.
21764578 CD133 and CD44 proteins were highly co-expressed in colorectal cancer with early liver metastases, and may be a potential biomarker for the early liver metastases.
21695188 Cell populations enriched for high ALDH activity alone are sufficient for efficient tumor-initiation with enhanced tumorigenic potential relative to CD133(+) and ALDH(low) cell populations in some direct xenograft tumors.
21602936 CD133(+) sorted embryonal rhabdomyosarcoma stem-like cell were subsequently shown to be more tumorigenic and more resistant to commonly used chemotherapeutics.
21591261 Data support the concept that prominin-1-containing lipid rafts may host key determinants necessary to maintain stem cell properties and their quantitative reduction or loss may result in cellular differentiation.
21559522 CD34+ CD133+ hematopoietic stem cells cultured with growth factors including Angptl5 efficiently engraft adult NOD-SCID Il2rgamma-/- (NSG) mice
21508381 High CD133 is associated with the development of distant metastasis as well as the occurrence of bone localization in breast carcinomas.
21486962 High levels of PROM1 transcript are are associated with medulloblastoma.
21479688 High CD133 mRNA expression was associated with treatment response in glioblastoma.
21462307 High CD133 expression levels in gastrointestinal stromal tumors
21457403 Sox17 might be a key transcription factor controlling CD133 expression, and that it might also play a role in the control of gastric tumor progression.
21448425 Data suggest that CD133+ cells play an important role in the invasiveness of cholangiocarcinoma.
21438906 CD133 expression is associated with small round blue cell tumour morphology in human central nervous system neoplasms
21436631 The study suggests a connection between CD133 and EGR1 and emphasises the importance of the EGR1/TCF4/CD133/LGR5 network in colorectal cancer.
21435437 CD133 positivity defines a genetically distinct cellular compartment in primary colorectal cancer cells
21415057 expression of EphA3 and CD133 in carcinoma was significantly higher than that in normal mucosal tissue
21412503 Upregulated CD133 expression plays a role in tumorigenesis colorectal cancer cells, which may promote the expression of other critical genes that can drive tumorigenesis.
21385990 These findings show the existence of cancer stem cells in human primary bone sarcomas and highlight CD133 as a pivotal marker for identification of these cells.
21372740 Intracoronary administration of bone marrow-derived, but not peripheral blood-derived CD133 cells 10-14 days after STEMI may improve long-term perfusion.
21360712 High CD133 mRNA expression is associated with colorectal cancer.
21331808 Elevated CD133 associated with Line-1 demethylation is associated with hepatocellular carcinoma.
21304102 CD133(+) progenitors can give rise in vitro, through definite steps, to mature, immunostimulatory dendritic cells with molecular features of Langerhans cells, although without Birbeck granules
21276138 the expression of CD133 and Her-1 may be correlative with prognosis in triple-negative breast cancer.
21238532 Data show that very small embryonic-like stem cells were isolated from CD34(+)/CD133(+)/CXCR4(+)/Lin(-) CD45(-) immature cells from bone marrow.
21220328 Studies provide molecular and genetic support for the stem cell-like nature of CD133(+) cells and an objective means for evaluating cancer aggressiveness.
21187924 analysis of CD133/prominin in human and mouse cells
21174061 CD133 is a temporary marker of cancer stem cells in small cell lung cancer, but not in non-small cell lung cancer.
21127401 CD133 was over expressed in healthy tissues and no prognostic role was identified for CD133.
21122138 findings support the hypotheses that CD133 expression in endometrial cancer may be epigenetically regulated and that cell fractions enriched for CD133+ cells may well contribute to endometrial cancer tumorigenicity, pathology and recurrence.
21082235 Data show that CD133(+) primary astrocytic glioblastomas comprise a proliferating, CD133(-)/telomerase(low) progenitor cell population characterized by low telomerase activity and shortened telomeres as compared to cancer stem cells.
21064103 High CD133 with KIT exon 11 mutations is associated with gastrointestinal stromal tumors.
21054902 Higher expressive level of CD133 mRNA is associated to lower Ki-67 LI and severer lymphatic metastasis in gastric adenocarcinoma.
20970309 Elevated CD133 gene expression was associated with distant recurrence and poor recurrence-free survival
20878131 Regulation of CD133 by epigenetic changes may provide an innovative mechanism of CD133 expression as its regulation still remains unclear.
20872808 Elevated CD133 mRNA levels are associated with more aggressive colorectal carcinoma.
20859302 Extraocular phenotype of RPOM1 mutations inclued abnormal endothelial function, renal infections, haematuria and recurrent miscarriages possibly reflecting abnormal tubular modelling.
20854168 These data indicate that SDF-1 is a key neuroprotective cytokine secreted by CD133-derived multipotent stromal cells that protects mouse neural progenitor cell through CXCR7.
20853315 Degree of plasticity exists between some AC133-positive and AC133-negative cancer stem cells.
20800872 Thus, the present study demonstrates that CD133 is not only a tumor-initiating cell marker but also a critical prognostic marker in endometrial cancer.
20800650 In this study, for the first time CD133 overexpression in U87MG human glioblastoma cells is involved in activating the MAP kinase/extracellular signal-regulated MAP kinase (Erk) pathway in vivo.
20717901 Mouse prominin-1 is widely expressed in prostate whereas in human only some luminal cells express it
20717756 non-small cell lung carcinoma patients with the dual expression of CD133 and ABCG2 have a high risk of early relapse
20711432 in vitro invasive properties and in vivo tumor growth of CD133+ colon cancer cells are enhanced in the presence of specific cancer-associated fibroblasts, CD10+ fibroblasts
20617370 results indicated CD133(+) subpopulation of SW480 SCPs bear heterogeneous invasive and metastatic ability, and CRC-CSCs might be a heterogeous subpopulation
20606680 Prognostic impact of this and other cancer stem cell markers expression in colorectal cancer.
20596619 In vitro study showed that CD133 protein was increased in a radiation-dose dependent manner.
20593500 Data show that transcriptional repression of CD133 is caused by promoter hypermethylation of the CD133 CpG islands in some of colorectal cancer cell lines.
20587144 The human colon cancer cell line, SW620, contains both CD133(+) and CD133(-) phenotypes, and the CD133(+) phenotype has characteristics consistent with those of cancer stem cells.
20564348 CD133 was selectively induced in serum-starved DAOY medulloblastoma cells but not in U87MG glioblastoma cells.
20560029 COMPARE-AMI trial: comparison of intracoronary injection of CD133+ bone marrow stem cells to placebo in patients after acute myocardial infarction and left ventricular dysfunction: study rationale and design.
20551139 sialylation modification contributes to the stability of CD133 protein
20530554 Akt and MAPK pathways are involved in the tumorigenesis of CD133 positive colon cancer cells.
20530428 A significant decrease of CD133 methylation was observed in the extent of stomach tumor. A trend was shown toward smaller maximal tumor size in tumors with demethylated CD133.
20526812 CD133+ CD44+ subgroups may be human small intestinal stem cells
20502714 CD133 expression in colorectal cancer is associated with some features attributable to stemness and there is plasticity of CD133 expression.
20487522 CD133 expression positively correlates with that of Ki-67 in gastric adenocarcinoma, suggesting a role in disease progression.
20428792 The aim of this study was to thoroughly examine antibody recognition and mRNA expression of CD133 in glioblastoma multiforme.
20395004 CD133 expression in hepatocellular carcinoma cells confers malignant potential which may contribute to the survival of the cells
20393116 Mutations in PROM1 have been described to cause a severe form of autosomal recessive retinitis pigmentosa in two families of Indian and Pakistani descent
20379837 CD133 expression is a potential prognostic indicator in intrahepatic cholangiocarcinoma; CD133 expression tended to be related to higher incidences of intrahepatic metastasis and positive expression of hypoxia-inducible factor-1alpha
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20347795 Intracoronary inoculation of CD133+ stem cells was safe and effective to improve ventricular contraction and symptomatic class function in patients with refractory post-infarct heart failure.
20346143 CD133 may have a role in chemo-resistant Ewing sarcoma cells
20333645 Membrane expression of the CD133 stem cell marker might undergo a complex regulation during differentiation of colon cells. HT29 cells are a useful model to study the mechanisms involved in this post-transcriptional regulation.
20309962 Glioblastoma multiforme stem cells, identified with the stem cell marker CD133, express high level of O6-methylguanine-DNA-methyltransferase (MGMT) known to be involved in chemotherapy resistance and highly expressed in the inner core of the tumor mass.
20196115 TGFbeta1 is able to regulate CD133 expression through inhibition of DNMT1 and DNMT3beta expression and subsequent demethylation of promoter-1.
20181261 CD133, CD15/SSEA-1, and CD34 do not resume tumor-initiating properties of long-term cultured malignant glio-neuronal stem cells
20167130 The Ras/ERK pathway at least in part contributes to the maintenance and the acquisition of stem-like hallmarks, although the extent of its contribution is varied in a cell type-specific manner.
20081809 Our results show for the first time that CD133+ colorectal tumors are more resistant to 5-fluorouracil-based chemotherapy.
20068153 CD133 is a cell surface molecule that is expressed on both CSC and differentiated tumor cells, but is probably differentially folded as a result of differential glycosylation to mask specific epitopes.
20062010 CD133(+) cancer stem cell expression in childhood malignant melanoma might correlate with lymph node and/or visceral metastasis and may have a low proliferative Ki-67 index that might explain their chemoresistance.
20056076 CD133 expressing L929 cells inhibites T cell proliferation and down-regulated the activation of CD4CD25 and CD8CD25 on T cells.
20042663 The authors propose that the hallmark of PROM1 truncating mutations is early and severe progressive degeneration of both rods and cones.
20023382 High expression of CD133 is associated with colon cancer.
19940551 Data show that tumor spheroid cells express ABCG2, Bmi1, WNT5A, CD133, prox1 and VEGFR3.
19904829 NOTCH pathway blockade depletes CD133 positive stem-like cells in glioblastoma multiforme through reduced proliferation and increased apoptosis.
19842219 CD133 could be a biliary and progenitor cell marker in vivo but it is not sufficient to detect tumor-initiating cells in cell lines.
19816957 data indicate that CD133 expression defines a NOD/SCID tumor initiating subpopulation of cells in human ovarian cancer
19805294 Data show that a tendency toward shorter progression-free survival in CD133+ NSCLC patients treated with platinum-containing regimens.
19786935 Results demonstrate that the expression of CD133 is down-regulated in IPMNs, suggesting that loss of CD133 expression might be a useful clinicopathological marker distinguishing IPMNs from ductal adenocarcinomas.
19760928 CD133 gene overexpression in early colorectal cancer patients was more frequently observed than in advanced cases.
19752721 Expressed in synovial sarcoma
19744348 CD133 expression in HCC was negatively associated with the presence of HBsAg. CD133 expression predicted poor disease-free survival independently of p53 expression
19724856 CD133 may play an important functional role in the growth of human glioma and hepatocellular carcinoma cells
19724847 Elevated CD133 may be a predictive marker of distant recurrence and poor survival after preoperative chemoradiotherapy in rectal cancer
19723143 CD133 stem cell antigen expression correlates with patient survival in rectal cancer, lending support to the current cancer stem cell hypothesis.
19718438 our studies demonstrate that Prom1-expressing cells are dispensable for gliomagenesis in this mouse model
19718270 PROML1 mutation analysis identified a novel single nucleotide insertion at position 1629 of the cDNA resulting in truncation of approximately one-third of the protein.
19676044 CD133 positivity may be indicative of drug resistance, but it is not a prognostic marker for survival in non-small lung cell cancer patients.
19657699 High CD133 levels are associated with distant recurrence after chemoradiotherapy in rectal cancer pateints.
19626493 Report prognostic significance of the cancer stem cell markers CD133, CD44, and CD166 in colorectal cancer.
19621338 CD133 expression is a marker with high prognostic impact for colon cancer, while it seems to have no obvious functional role as a driving force of this malignancy
19584075 Observational study of gene-disease association. (HuGE Navigator)
19583859 CD133 antigen is expressed in ovarian cancer
19583834 Higher percentage of CD133+ cells is associated with poor prognosis in colon carcinoma patients with Stage IIIB.
19509143 CD133 is expressed by human endometrial cancers and might represent a valuable tool to identify cells with cancer stem cell characteristics.
19430532 Data suggest the possibility that CD133 may be specifically down-regulated during G0/G1, and this should be considered when this marker is used to identify and isolate other tissue and cancer stem cells.
19404394 CD133 is highly expressed on tumor cells but not on neighboring normal thyroid cells
19385971 CD133 alone cannot be used as a stem cell marker for the lung cancer cells A549 and H446, and both the CD133+ and CD133- subpopulations contain similar numbers of cancer stem cells.
19369008 we reviewed the rise of CD133 as the marker to sort brain tumor stem cells
19342601 Human CD133+ progenitor cells promote the healing of diabetic ischemic ulcers by paracrine stimulation of angiogenesis and activation of Wnt signaling.
19216024 study suggests that selected gangliosides could modulate the accessibility of CD133 and regulate cell-cell contacts involving CD133(+) stem cells at the earliest steps of tumour development
19153665 Results identify a subpopulation of CD133(+) cells expressing the B-cell marker CD20, which display myogenic properties.
19147788 Leukemia-initiating cells in childhood B-ALL have a primitive CD133(+)/CD19(-) and CD38(-) phenotype.
19047148 Unlike normal adult prostate stem cells, prostate cancer initiating cells are AR+ and do not require functional CD133.
19017033 Epithelial and endothelial CD133 expression was not detected in patients with type 2 diabetes and periodontitis. Stromal CD133 expression was lower in patients with type 2 diabetes and periodontitis and was increased in periodontitis patients.
18985161 The concept that CD133 is a marker of brain tumor stem cells may need to be revised.
18853445 Only a small proportion of cells in the Hep-2 cell line express the CD133 marker, indicating that CD133 is not the exclusive marker of Hep-2 cell line stem cells.
18836486 CD133 transcription is epigenetically controlled by both histone modifications and promoter methylation. CD133 demarcates an ovarian cancer-initiating cell population.
18829568 The CD133 DNA methylation seems to constitute an abnormal promoter signature because it is not found in normal brain and colon but only in cultured and primary tumors.
18829544 The association of AC133 with actively cycling cells may contribute to the basis for enrichment for tumor-initiating activity.
18802032 CD133, in addition to its role as a cancer stem cell marker, is an important therapeutic target for metastatic melanoma
18781171 CD133 expression in colorectal cancer is an independent prognostic marker
18754869 CD133 overexpression is a risk factor for poorer overall survival in patients with well- and moderately-differentiated adenocarcinoma
18702870 diagnostic value of clone AC141 of CD133 antibody by flow cytometry in acute leukemia
18679414 DNA hypomethylation is an important determinant of CD133 expression in glioblastomas, and this epigenetic event may be associated with the development of Brain tumor-initiating cells expressing CD133.
18654668 Mutant PROM1 found in patients with macular degeneration disrupts photoreceptor disk morphogenesis in mice.
18645205 Overall expression of human prominin-1 is beyond the rare primitive cells, and it seems to be a general marker of apical or apicolateral membrane of glandular epithelia.
18644979 ALDH, expressed along CD133, can more specifically characterize the tumorigenic liver cancer stem cells population.
18602031 The methylation of promoter P2 was tissue specific, and hypomethylation of this promoter is probably necessary but not sufficient for efficient transcription of the PROM1 gene.
18568776 Report a correlation between expression of CD133 and drug resistance in glioblastomas.
18542072 hepatocellular, pancreatic and gastric cancer cell lines expressed CD133 at levels higher than normal epithelial cells or bone marrow progenitor cells.
18511311 CD133 associates with the endosomal compartment of mitotic hHSCs
18497883 CD133 has roles in metastatic colon cancer and is expressed in colon cancer stem cells
18410526 The phenotypic, functional and gene expression differences between endothelial progenitor cells and lymphatic and macrovascular endothelial cells isolated were compared.
18403755 Relevant animal models can reliably preserve CD133(+) tumor cell pools even during serial in vivo subtransplantations.
18402255 CD133 which might be correlated with the development and progression of neuroblastoma can serve as one of the important indicators for prognosis of neuroblastoma.
18398820 Study provides a unique genome-wide molecular signature of CD133+ and CD133- human prostate epithelial cells.
18398462 analysis of CD133-expression and neuronal lineage differentiation potential in high-grade glioma
18374086 CD133 molecule represents another cell surface marker suitable for identification and isolation of pancreatic endocrine progenitors.
18371181 cancer stem cells and expression of CD133 is predictive of prognosis in high-grade oligodendroglial tumors.
18192867 data show that pancreatic duct cells express prominin-1 and surprisingly reveal that its particular AC133 epitope is not an exclusive stem and progenitor cell marker
18172261 CD133 stem cell antigen expression correlates with patient survival in gliomas.
18096722 Human cerebrospinal fluid contains specific membrane particles that carry prominin-1/CD133, a neural stem cell marker implicated in brain tumors, notably glioblastoma.
17999603 The neurotransmitter GABA is a potent blocker of the SDF-1alpha-induced migration of CD133(+) hematopoietic stem and progenitor cells from mobilized peripheral blood.
17977646 Data show that a reduction in the oxygen level in these cell cultures dramatically increases the percentage of CD133 expressing cells.
17912948 Here we tested the safety of autologous transplantation of muscle-derived CD133+ cells in eight boys with Duchenne muscular dystrophy in a 7-month, double-blind phase I clinical trial.
17883595 Tissue factor expression contributes to tumor growth/regulating properties of CD133-positive tumor stem cells.
17868344 CD133-1 and CD133-2 may be useful in order to select and enrich the population of CD133(+) ovarian tumor cells, which are characterized by a higher clonogenic efficiency and proliferative potential.
17785371 Novel germ cell markers PROM1 were significantly upregulated in seminoma specimens, compared to normal testes.
17605847 Expression of CD133 in bone marrow cells of patients with acute leukemia is higher than that in control group.
17605048 phenotypic characteristics of retinopathy caused by nonsense mutations in PROM1
17594720 Elevated circulating endothelial progenitor marker CD133 messenger RNA levels are associated with colon cancer recurrence
17545092 Data show that CD133 and ECE expressions are associated with lymphoid metastasis and prognosis of NSCLC, and their overexpression often suggests unfavorable prognosis of NSCLC.
17487431 Comparative genomics on PROM1 gene encoding stem cell marker CD133.
17253947 The differences between the gene expression profiles of CD34(+) and CD133(+) cells indicate the more primitive nature of CD133(+) cells suggesting that CD34(+) and CD133(+) cells may have different roles in hematopoietic regeneration.
17205516 CD133 positive hepatocellular carcinoma cells possess high capacity for tumorigenicity
17122772 colon cancer is created and propagated by a small number of undifferentiated tumorigenic CD133+ cells
17077937 CD133-posistive and CD133-negative glioma cells may be similarly resistant to immune surveillance, but INF-gamma may partially restore their immunogenicity and potentiate their lysis by NK cells.
17077324 sialomucin endolyn (CD164), an adhesion receptor that regulates the adhesion of CD34+ cells to bone marrow stroma and the recruitment of CD34+CD38(lo/-) cells into cycle, associates with CXCR4
16914572 CD133 mRNA expression is increased in cancer patients with metastatic disease, specifically with bone metastasis. In addition, CD133 mRNA expression seems to be an independent prognostic factor for overall survival.
16439688 New cd133+ cell subpopulation, which is apparently a precursor classical endothelial progenitor cells more potent with respect too homing and vasscular repair.
15558321 In adults, the expression of human prominin-1 is not limited to stem and progenitor cells, and the epitopes of prominin-1 might be useful for investigating solid cancers.
15254585 Data report that a subpopulation of circulating cells expressing AC133 can restore dystrophin expression and ameliorate function in dystrophic skeletal muscle.
15231568 redistribute several lipid raft markers including cholesterol-binding protein prominin-1 (CD133) in specialized plasma membrane domains
15226377 a small population (approximately 1%) of human prostate basal cells express the cell surface marker CD133
15115691 immediately after separation, 96.75+/-0.58% of CD133+ cells and 97.04+/-1.76% of CD133- cells were in G0/G1-phase
14630820 transcription of AC133 isoforms is controlled by 5 alternative promoters, and in vitro methylation of 2 of these AC133 promoters completely suppresses their activity, suggesting that methylation plays a role in their regulation
12657606 A new locus was identified for a bull's-eye macular dystrophy on the short arm of chromosome 4.

AA Sequence

MALVLGSLLLLGLCGNSFSGGQPSSTDAPKAWNYELPATNYETQDSHKAGPIGILFELVHIFLYVVQPRD      1 - 70
FPEDTLRKFLQKAYESKIDYDKPETVILGLKIVYYEAGIILCCVLGLLFIILMPLVGYFFCMCRCCNKCG     71 - 140
GEMHQRQKENGPFLRKCFAISLLVICIIISIGIFYGFVANHQVRTRIKRSRKLADSNFKDLRTLLNETPE    141 - 210
QIKYILAQYNTTKDKAFTDLNSINSVLGGGILDRLRPNIIPVLDEIKSMATAIKETKEALENMNSTLKSL    211 - 280
HQQSTQLSSSLTSVKTSLRSSLNDPLCLVHPSSETCNSIRLSLSQLNSNPELRQLPPVDAELDNVNNVLR    281 - 350
TDLDGLVQQGYQSLNDIPDRVQRQTTTVVAGIKRVLNSIGSDIDNVTQRLPIQDILSAFSVYVNNTESYI    351 - 420
HRNLPTLEEYDSYWWLGGLVICSLLTLIVIFYYLGLLCGVCGYDRHATPTTRGCVSNTGGVFLMVGVGLS    421 - 490
FLFCWILMIIVVLTFVFGANVEKLICEPYTSKELFRVLDTPYLLNEDWEYYLSGKLFNKSKMKLTFEQVY    491 - 560
SDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELESLKVNLNIFLLGAAGRKNLQDFAACGIDRMN    561 - 630
YDSYLAQTGKSPAGVNLLSFAYDLEAKANSLPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVK    631 - 700
ILQRTGNGLLERVTRILASLDFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKP    701 - 770
VATALDTAVDVFLCSYIIDPLNLFWFGIGKATVFLLPALIFAVKLAKYYRRMDSEDVYDDVETIPMKNME    771 - 840
NGNNGYHKDHVYGIHNPVMTSPSQH                                                 841 - 865
//

Text Mined References (423)

PMID Year Title
26898076 2015 Expression of CD133 and CD117 in 64 Serous Ovarian Cancer Cases.
26758620 2016 CD133+ liver cancer stem cells resist interferon-gamma-induced autophagy.
26722393 2015 Prognostic value of cancer stem cell marker CD133 expression in pancreatic ductal adenocarcinoma (PDAC): a systematic review and meta-analysis.
26702251 2015 An intronic deletion in the PROM1 gene leads to autosomal recessive cone-rod dystrophy.
26690524 2015 CD133 and BMI1 expressions and its prognostic role in primary glioblastoma.
26625750 2015 Clinicopathological Significance of CD133 and ALDH1 Cancer Stem Cell Marker Expression in Invasive Ductal Breast Carcinoma.
26608413 2016 Immunohistochemical expression of cancer stem cell related markers CD44 and CD133 in endometrial cancer.
26539911 2015 Transcriptional repression of cancer stem cell marker CD133 by tumor suppressor p53.
26530530 2016 Latexin exhibits tumor-suppressor potential in pancreatic ductal adenocarcinoma.
26515729 2015 Polarized cell migration induces cancer type-specific CD133/integrin/Src/Akt/GSK3?/?-catenin signaling required for maintenance of cancer stem cell properties.
26511095 2016 Intragenic G-quadruplex structure formed in the human CD133 and its biological and translational relevance.
26503471 2015 CD133 overexpression correlates with clinicopathological features of gastric cancer patients and its impact on survival: a systematic review and meta-analysis.
26442717 2016 Clinical significance of stem cell marker CD133 expression in colorectal cancer.
26406410 2015 Association of CD133 polymorphisms and response to bevacizumab in patients with metastatic colorectal cancer.
26403404 CD133 EXPRESSION COULD BE A PREDICTIVE MARKER OF PERIODONTAL REGENERATION.
26370320 2015 Ultrasound-targeted microbubble destruction-mediated downregulation of CD133 inhibits epithelial-mesenchymal transition, stemness and migratory ability of liver cancer stem cells.
26298632 2015 The clinicopathological and prognostic significance of CD24, CD44, CD133, ALDH1 expressions in invasive ductal carcinoma of the breast: CD44/CD24 expression in breast cancer.
26293462 2015 Residential Proximity to Major Roadways Is Associated With Increased Levels of AC133+ Circulating Angiogenic Cells.
26261540 2015 Overexpression of PROM1 (CD133) confers poor prognosis in non-small cell lung cancer.
26191258 2015 Predictive and prognostic effect of CD133 and cancer-testis antigens in stage Ib-IIIA non-small cell lung cancer.
26183533 2015 Control of AC133/CD133 and impact on human hematopoietic progenitor cells through nucleolin.
26176038 2014 Prognostic Value of the Stem Cell Markers Epcam and CD133 Expression Of Gallbladder Adenocarcinoma.
26153215 2016 Homozygosity mapping and whole-genome sequencing reveals a deep intronic PROM1 mutation causing cone-rod dystrophy by pseudoexon activation.
26141860 2015 Microenvironment-Modulated Metastatic CD133+/CXCR4+/EpCAM- Lung Cancer-Initiating Cells Sustain Tumor Dissemination and Correlate with Poor Prognosis.
26110599 2016 INSIGHTS INTO AUTOSOMAL DOMINANT STARGARDT-LIKE MACULAR DYSTROPHY THROUGH MULTIMODALITY DIAGNOSTIC IMAGING.
26095609 2015 ANXA3/JNK Signaling Promotes Self-Renewal and Tumor Growth, and Its Blockade Provides a Therapeutic Target for Hepatocellular Carcinoma.
26092504 2015 Clinical and biological significance of stem-like CD133(+)CXCR4(+) cells in esophageal squamous cell carcinoma.
26081615 2015 Bmi-1 is essential for the oncogenic potential in CD133(+) human laryngeal cancer cells.
26068177 2015 Cancer Stem Cell Markers Are Associated With Distant Hematogenous Liver Metastases But Not With Peritoneal Carcinomatosis in Colorectal Cancer.
26046383 2015 Differential Expression of Cancer Stem Cell Markers ALDH1 and CD133 in Various Lung Cancer Subtypes.
26029999 2015 Mutation of N-linked glycosylation at Asn548 in CD133 decreases its ability to promote hepatoma cell growth.
26020117 2015 Identification of a distinct population of CD133(+)CXCR4(+) cancer stem cells in ovarian cancer.
26002465 2015 Chemoresistance of CD133(+) colon cancer may be related with increased survivin expression.
25967234 2015 Do relevant markers of cancer stem cells CD133 and Nestin indicate a poor prognosis in glioma patients? A systematic review and meta-analysis.
25921286 2015 Clinicopathological significance and prognostic value of the expression of the cancer stem cell marker CD133 in hepatocellular carcinoma: a meta-analysis.
25862862 2015 The relationship of CD133, histone deacetylase 1 and thrombospondin-1 in gastric cancer.
25840983 2015 Effective Eradication of Glioblastoma Stem Cells by Local Application of an AC133/CD133-Specific T-cell-Engaging Antibody and CD8 T Cells.
25829252 2015 CD133 initiates tumors, induces epithelial-mesenchymal transition and increases metastasis in pancreatic cancer.
25823028 2016 CD133 and DNA-PK regulate MDR1 via the PI3K- or Akt-NF-?B pathway in multidrug-resistant glioblastoma cells in vitro.
25788271 2015 CD133+ ovarian cancer stem-like cells promote non-stem cancer cell metastasis via CCL5 induced epithelial-mesenchymal transition.
25783528 2015 Antagomir-1290 suppresses CD133? cells in non-small cell lung cancer by targeting fyn-related Src family tyrosine kinase.
25735334 2015 Effect of CXCR4 and CD133 co-expression on the prognosis of patients with stage II~III colon cancer.
25727099 2015 Prognostic value of circulating CD133(+) cells in patients with gastric cancer.
25724578 2015 CD133 marks a stem cell population that drives human primary myelofibrosis.
25710579 Prognostic Significance of CD44v6, CD133, CD166, and ALDH1 Expression in Small Intestinal Adenocarcinoma.
25625240 2015 Colon cancer stem cell markers CD44 and CD133 in patients with colorectal cancer and synchronous hepatic metastases.
25605013 2015 Galectin-1 is overexpressed in CD133+ human lung adenocarcinoma cells and promotes their growth and invasiveness.
25589004 2016 Clinicopathological and Prognostic Significance of CD133 in Glioma Patients: A Meta-Analysis.
25551472 2014 Latexin inhibits the proliferation of CD133+ miapaca-2 pancreatic cancer stem-like cells.
25487874 2015 Cell-surface Vimentin: A mislocalized protein for isolating csVimentin(+) CD133(-) novel stem-like hepatocellular carcinoma cells expressing EMT markers.
25449786 2015 CD133? melanoma subpopulation acquired resistance to caffeic acid phenethyl ester-induced apoptosis is attributed to the elevated expression of ABCB5: significance for melanoma treatment.
25436343 2014 CD133 expression is correlated with poor prognosis in colorectal cancer.
25433813 2015 Differential CD133 expression distinguishes malignant from benign papillary lesions of the breast.
25426558 2015 Patient-derived glioblastoma stem cells are killed by CD133-specific CAR T cells but induce the T cell aging marker CD57.
25339008 2014 Prognostic significance of expression of CD133 and Ki-67 in gastric cancer.
25339000 2014 Co-expression of putative cancer stem cell markers, CD133 and Nestin, in skin tumors.
25331798 Transcriptome analysis of CD133-positive stem cells and prognostic value of survivin in colorectal cancer.
25311946 2015 Mir-152 inhibits cell proliferation and colony formation of CD133(+) liver cancer stem cells by targeting KIT.
25301737 2014 Inhibitory effects of transcription factor Ikaros on the expression of liver cancer stem cell marker CD133 in hepatocellular carcinoma.
25269803 2014 Human CD133-positive hematopoietic progenitor cells initiate growth and metastasis of colorectal cancer cells.
25256670 2014 CRTC2 and PROM1 expression in non-small cell lung cancer: analysis by Western blot and immunohistochemistry.
25230779 2014 Overexpression of CD133 enhances chemoresistance to 5-fluorouracil by activating the PI3K/Akt/p70S6K pathway in gastric cancer cells.
25184684 2014 Prominin-1 (CD133) defines both stem and non-stem cell populations in CNS development and gliomas.
25168019 2015 Aberrant expression of cancer stem cell markers (CD44, CD90, and CD133) contributes to disease progression and reduced survival in hepatoblastoma patients: 4-year survival data.
25120750 2014 Clinical value of CD133 and nestin in patients with glioma: a population-based study.
25082219 2014 CD133-enriched Xeno-Free human embryonic-derived neural stem cells expand rapidly in culture and do not form teratomas in immunodeficient mice.
25015418 2014 Regulatory role of miR-142-3p on the functional hepatic cancer stem cell marker CD133.
25010141 2015 CD133 expression correlates with membrane beta-catenin and E-cadherin loss from human hair follicle placodes during morphogenesis.
24964207 2014 Genetic relationships between suicide attempts, suicidal ideation and major psychiatric disorders: a genome-wide association and polygenic scoring study.
24962344 2014 Strong correlation between N-cadherin and CD133 in breast cancer: role of both markers in metastatic events.
24940615 2014 Is CD133 expression a prognostic biomarker of non-small-cell lung cancer? A systematic review and meta-analysis.
24920554 2014 Co-expression of CD133, CD44v6 and human tissue factor is associated with metastasis and poor prognosis in pancreatic carcinoma.
24911657 2014 Human prominin-1 (CD133) is detected in both neoplastic and non-neoplastic salivary gland diseases and released into saliva in a ubiquitinated form.
24864242 2014 Immunohistochemical detection of cancer stem cell related markers CD44 and CD133 in metastatic colorectal cancer patients.
24839953 2014 Coexpression of CD44-positive/CD133-positive cancer stem cells and CD204-positive tumor-associated macrophages is a predictor of survival in pancreatic ductal adenocarcinoma.
24804195 2014 Expressions of ABCG2, CD133, and podoplanin in salivary adenoid cystic carcinoma.
24798639 2014 Expansion of prominin-1-expressing cells in association with fibrosis of biliary atresia.
24763286 2014 Molecular diagnosis of putative Stargardt disease by capture next generation sequencing.
24758564 2014 Clinicopathological significance of cancer stem cells marked by CD133 and KAI1/CD82 expression in laryngeal squamous cell carcinoma.
24727449 2014 DDX4 (DEAD box polypeptide 4) colocalizes with cancer stem cell marker CD133 in ovarian cancers.
24630518 2014 Overexpression of B7-H3 in CD133+ colorectal cancer cells is associated with cancer progression and survival in human patients.
24586330 2014 Prognostic value of stem cell quantification in stage II colon cancer.
24556617 2014 Post-translational regulation of CD133 by ATase1/ATase2-mediated lysine acetylation.
24547909 2015 Pediatric Cone-Rod Dystrophy with High Myopia and Nystagmus Suggests Recessive PROM1 Mutations.
24511670 2013 Effect of CD133-positive stem cells in repeated recurrence of hepatocellular carcinoma after liver transplantation: a case report.
24484648 2014 Identification and validation of PROM1 and CRTC2 mutations in lung cancer patients.
24468059 2014 CD133 facilitates epithelial-mesenchymal transition through interaction with the ERK pathway in pancreatic cancer metastasis.
24467938 2014 CD133+ renal stem cells always co-express CD24 in adult human kidney tissue.
24449656 Partition behavior of CD133(+) stem cells from human umbilical cord blood in aqueous two-phase systems: In route to establish novel stem cell primary recovery strategies.
24436149 2014 CD133+ cancer stem-like cells in small cell lung cancer are highly tumorigenic and chemoresistant but sensitive to a novel neuropeptide antagonist.
24366104 2014 Molecular characterization of CD133+ cancer stem-like cells in endometrial cancer.
24335569 2014 Inverse correlation between circulating endothelial progenitor cells with CD34+CD133+ and the severity of coronary atherosclerosis assessed by Syntax score.
24330829 2013 In triple negative breast tumor cells, PLC-?2 promotes the conversion of CD133high to CD133low phenotype and reduces the CD133-related invasiveness.
24302553 2015 Polymorphisms at the microRNA binding-site of the stem cell marker gene CD133 modify susceptibility to and survival of gastric cancer.
24300467 2014 Molecular portraits of heterogeneity related to cancer stem cells in human ovarian cancer.
24299311 2014 CD133 positive cells isolated from A549 cell line exhibited high liver metastatic potential.
24228135 2013 Prognostic value of cancer stem cell marker CD133 expression in non-small cell lung cancer: a systematic review.
24146103 2013 Glucose transporter-1 expression in CD133+ laryngeal carcinoma Hep-2 cells.
24129546 2013 Correlation between the prognostic value and the expression of the stem cell marker CD133 and isocitrate dehydrogenase1 in glioblastomas.
24102054 2013 CD133 expression in normal skin and in epithelial cutaneous tumors.
24054866 2014 Quantification of peripheral blood CD133 mRNA in identifying metastasis and in predicting recurrence of patients with clear cell renal cell carcinoma.
24008862 2013 The role of CD133 expression in the carcinogenesis and prognosis of patients with lung cancer.
23991844 2013 Expansion of CD133-positive glioma cells in recurrent de novo glioblastomas after radiotherapy and chemotherapy.
23962788 2014 Androgen receptor increases CD133 expression and progenitor-like population that associate with cisplatin resistance in endometrial cancer cell line.
23917144 2013 Inflammation-related DNA damage and expression of CD133 and Oct3/4 in cholangiocarcinoma patients with poor prognosis.
23861881 2013 miR-1915 and miR-1225-5p regulate the expression of CD133, PAX2 and TLR2 in adult renal progenitor cells.
23851436 2013 The expression of S100A4 in human pancreatic cancer is associated with invasion.
23840432 2013 hypoxia-inducible factors activate CD133 promoter through ETS family transcription factors.
23777983 2013 CD 133+ and CXCR4+ colon cancer cells as a marker for lymph node metastasis.
23734191 2013 Investigating the link between molecular subtypes of glioblastoma, epithelial-mesenchymal transition, and CD133 cell surface protein.
23715500 2013 A microRNA-135a/b binding polymorphism in CD133 confers decreased risk and favorable prognosis of lung cancer in Chinese by reducing CD133 expression.
23708735 2013 CD133+ subpopulation of the HT1080 human fibrosarcoma cell line exhibits cancer stem-like characteristics.
23701640 2014 HGF and SDF-1-mediated mobilization of CD133+ BMSC for hepatic regeneration following extensive liver resection.
23661576 2013 CD133 expression in circulating tumor cells from breast cancer patients: potential role in resistance to chemotherapy.
23658323 2013 The expression status of CD133 is associated with the pattern and timing of primary glioblastoma recurrence.
23619912 2013 MiR-142-3p functions as a tumor suppressor by targeting CD133, ABCG2, and Lgr5 in colon cancer cells.
23615455 2013 Expression of CD133 in neuroendocrine neoplasms of the digestive tract: a detailed immunohistochemical analysis.
23609373 2013 Clinicopathologic significance of putative stem cell marker, CD44 and CD133, in human gastric carcinoma.
23604326 2013 Biological characteristics of CD133(+) cells in nasopharyngeal carcinoma.
23593389 2013 G protein-coupled receptor 87 (GPR87) promotes the growth and metastasis of CD133? cancer stem-like cells in hepatocellular carcinoma.
23584268 2013 CD133 is a selective marker of CRC?
23569237 2013 Activation of PI3K/Akt pathway by CD133-p85 interaction promotes tumorigenic capacity of glioma stem cells.
23558457 2014 Expression of CD133 in the cytoplasm is associated with cancer progression and poor prognosis in gastric cancer.
23545719 2013 Expression and localisation of osteopontin and prominin-1 (CD133) in patients with endometriosis.
23533603 2013 Prognostic value of cancer stem cell marker CD133 expression in gastric cancer: a systematic review.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23532815 2013 Expression of CD133 in acute leukemia.
23495873 2013 CD133, a stem cell marker in mice: results in animal models cannot always be applied to human skin.
23470693 2013 Genome-wide association studies of pit-and-fissure- and smooth-surface caries in permanent dentition.
23448401 2013 Significance of CD133 expression in esophageal squamous cell carcinoma.
23438193 2013 Positive correlation of Oct4 and ABCG2 to chemotherapeutic resistance in CD90(+)CD133(+) liver cancer stem cells.
23437259 2013 CD133/prominin-1-mediated autophagy and glucose uptake beneficial for hepatoma cell survival.
23409180 2013 CD133 expression and the prognosis of colorectal cancer: a systematic review and meta-analysis.
23408993 2013 Peripheral blood mononuclear CD133 mRNA levels correlates with response to treatment in patients with gastrointestinal stromal tumors.
23396254 2012 CD133 is a predictor of poor survival in head and neck squamous cell carcinomas.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23340741 2013 CD133 glycosylation is enhanced by hypoxia in cultured glioma stem cells.
23326490 2013 The cancer stem cell marker CD133 interacts with plakoglobin and controls desmoglein-2 protein levels.
23322518 2013 AC133 expression associated with poor prognosis in stage II colorectal cancer.
23318676 2013 Wnt interaction and extracellular release of prominin-1/CD133 in human malignant melanoma cells.
23276935 2013 CD133+ cancer stem cells in lung cancer.
23252868 2012 Expression of the potential cancer stem cell markers, CD133, CD44, ALDH1, and ?-catenin, in primary lung adenocarcinoma--their prognostic significance.
23245659 2012 MGMT promoter methylation status and MGMT and CD133 immunohistochemical expression as prognostic markers in glioblastoma patients treated with temozolomide plus radiotherapy.
23233126 2013 CD133 silencing inhibits stemness properties and enhances chemoradiosensitivity in CD133-positive liver cancer stem cells.
23216926 2012 Prognostic role of CD133 expression in colorectal cancer: a meta-analysis.
23216238 2012 The ultrastructural difference between CD133-positive U251 glioma stem cells and normal U251 glioma cells.
23206244 2013 DNA damage response in CD133 + stem/progenitor cells from umbilical cord blood: low level of endogenous foci and high recruitment of 53BP1.
23195431 2013 CD133 affects the invasive ability of HCT116 cells by regulating TIMP-2.
23170850 2012 Aberrant expression of CD133 in non-small cell lung cancer and its relationship to vasculogenic mimicry.
23150174 2013 CD133 induces tumour-initiating properties in HEK293 cells.
23150059 2013 The stem cell marker prominin-1/CD133 interacts with vascular endothelial growth factor and potentiates its action.
23138940 2013 Growth kinetics of CD133-positive prostate cancer cells.
23106300 2012 CD133: holy of grail of neuro-oncology or promiscuous red-herring?
23084749 2012 Regulation of CD133 by HDAC6 promotes ?-catenin signaling to suppress cancer cell differentiation.
23071857 2012 Expression of the stem cell markers CD133 and nestin in pancreatic ductal adenocarcinoma and clinical relevance.
23065858 2014 Differential expression of CD133 based on microsatellite instability status in human colorectal cancer.
23064961 2013 GWAS of dental caries patterns in the permanent dentition.
23055022 2013 Expression patterns of Thymosin ?4 and cancer stem cell marker CD133 in ovarian cancers.
23049880 2012 CD133 is a useful surrogate marker for predicting chemosensitivity to neoadjuvant chemotherapy in breast cancer.
23045288 2013 Human osteosarcoma CD49f(-)CD133(+) cells: impaired in osteogenic fate while gain of tumorigenicity.
22964855 2012 Rapid re-expression of CD133 protein in colorectal cancer cell lines in vitro and in vivo.
22964035 2012 Increased expression of CD133 and reduced dystroglycan expression are strong predictors of poor outcome in colon cancer patients.
22960282 2012 Cross species analysis of Prominin reveals a conserved cellular role in invertebrate and vertebrate photoreceptor cells.
22945648 2013 Epigenetic regulation of CD133/PROM1 expression in glioma stem cells by Sp1/myc and promoter methylation.
22944295 2012 Expression of stem-cell markers OCT-4 and CD133: important prognostic factors in papillary renal cell carcinoma.
22922842 2012 Clonal dominance of CD133+ subset population as risk factor in tumor progression and disease recurrence of human cutaneous melanoma.
22871210 2012 CD133(+)CXCR4(+) colon cancer cells exhibit metastatic potential and predict poor prognosis of patients.
22865455 2012 CD133+ melanoma subpopulations contribute to perivascular niche morphogenesis and tumorigenicity through vasculogenic mimicry.
22842095 2013 Perivascular stem cell niche in head and neck cancer.
22830353 2013 Expression of stem cell markers, CD133 and CD44, in pediatric solid tumors: a study using tissue microarray.
22782852 2013 Expression patterns of cancer stem cell markers ALDH1 and CD133 correlate with a high risk of malignant transformation of oral leukoplakia.
22748652 2012 CD133 as a marker for regulation and potential for targeted therapies in glioblastoma multiforme.
22740326 2013 Co-expression of CD133(+)/CD44(+) in human colon cancer and liver metastasis.
22739150 2012 [Expression of two subtype molecules of CD133 in childhood with B linage acute lymphoblastic leukemia and its clinical significance].
22668828 2013 Glioblastoma cancer stem cells--from concept to clinical application.
22664874 2012 Tumor-associated microglia/macrophages enhance the invasion of glioma stem-like cells via TGF-?1 signaling pathway.
22652175 2012 A distinct subpopulation within CD133 positive brain tumor cells shares characteristics with endothelial progenitor cells.
22623141 2012 Protein cross-talk in CD133+ colon cancer cells indicates activation of the Wnt pathway and upregulation of SRp20 that is potentially involved in tumorigenicity.
22614155 2012 CD133 expression in renal cell carcinoma (RCC) is correlated with nuclear hypoxia-inducing factor 1? (HIF-1?).
22571340 2012 CD133 negatively regulates tumorigenicity via AKT pathway in synovial sarcoma.
22529031 2012 Characterization of a new human melanoma cell line with CD133 expression.
22514116 2012 Genotype analysis of tumor-initiating cells expressing CD133 in neuroblastoma.
22496204 2012 Mutations in the Ras-Raf Axis underlie the prognostic value of CD133 in colorectal cancer.
22453233 2012 Increased CD133 expression after preoperative chemoradiotherapy in rectal cancers other than mucin-rich tumors.
22448662 2012 Diagnostic utility of CD117, CD133, SALL4, OCT4, TCL1 and glypican-3 in malignant germ cell tumors of the ovary.
22431923 2012 The brain microenvironment preferentially enhances the radioresistance of CD133(+) glioblastoma stem-like cells.
22408058 2013 CD133 marks a myogenically primitive subpopulation in rhabdomyosarcoma cell lines that are relatively chemoresistant but sensitive to mutant HSV.
22395973 2012 Integration of global spectral karyotyping, CGH arrays, and expression arrays reveals important genes in the pathogenesis of glioblastoma multiforme.
22395309 2012 Expressions of putative cancer stem cell markers ABCB1, ABCG2, and CD133 are correlated with the degree of differentiation of gastric cancer.
22394107 2012 CD133 expression is associated with poor outcome in neuroblastoma via chemoresistance mediated by the AKT pathway.
22337994 2012 The mixed lineage leukemia (MLL) fusion-associated gene AF4 promotes CD133 transcription.
22322379 2012 Epithelial mesenchymal transition correlates with CD24+CD44+ and CD133+ cells in pancreatic cancer.
22315171 2012 Correlation of aberrant expression of CD133 with FHIT and malignant phenotype of colorectal adenocarcinoma.
22246536 2012 Magnetic field-based delivery of human CD133? cells promotes functional recovery after rat spinal cord injury.
22246526 2012 Immunohistochemical detection of CD133 is associated with tumor regression grade after chemoradiotherapy in rectal cancer.
22236447 Prognostic value of the stem cell markers CD133 and ABCG2 expression in esophageal squamous cell carcinoma.
22231565 2013 Pharmacogenetic profiling of CD133 is associated with response rate (RR) and progression-free survival (PFS) in patients with metastatic colorectal cancer (mCRC), treated with bevacizumab-based chemotherapy.
22199321 2011 The cancer stem cell antigens CD133, BCRP1/ABCG2 and CD117/c-KIT are not associated with prognosis in resected early-stage non-small cell lung cancer.
22178090 2012 The pathological characteristics of glioma stem cell niches.
22157717 2012 CD133+ colon cancer cells are more interactive with the tumor microenvironment than CD133- cells.
22156015 2011 CD133 expression and identification of CD133/nestin positive cells in rhabdomyosarcomas and rhabdomyosarcoma cell lines.
22140506 2011 CD133/Src axis mediates tumor initiating property and epithelial-mesenchymal transition of head and neck cancer.
22130902 2012 Effect of EpCAM, CD44, CD133 and CD166 expression on patient survival in tumours of the ampulla of Vater.
22130040 2012 Increased membrane shedding--indicated by an elevation of CD133-enriched membrane particles--into the CSF in partial epilepsy.
22123613 2012 Anti-glioma response of autologous T cells stimulated by autologous dendritic cells electrofused with CD133+ or CD133- glioma cells.
22119814 2011 The utility of CD44, CD117 and CD133 in identification of cancer stem cells (CSC) in oral squamous cell carcinomas (OSCC).
22079466 2012 CD133+ liver cancer stem cells modulate radioresistance in human hepatocellular carcinoma.
22076958 2012 CD133 and CD44 are universally overexpressed in GIST and do not represent cancer stem cell markers.
22072879 2011 Quantum dots affect expression of CD133 surface antigen in melanoma cells.
22049795 2011 [Expressions of integrinalpha2beta1 and CD133 in benign prostatic hyperplasia complicated by prostatitis and their significance].
22025269 2012 microRNA-150 inhibits human CD133-positive liver cancer stem cells through negative regulation of the transcription factor c-Myb.
22008114 2011 [The utilization and limitation of CD133 epitopes in lung cancer stem cells research].
21994122 2012 CD133(+) liver tumor-initiating cells promote tumor angiogenesis, growth, and self-renewal through neurotensin/interleukin-8/CXCL1 signaling.
21966538 2011 The importance of the stem cell marker prominin-1/CD133 in the uptake of transferrin and in iron metabolism in human colon cancer Caco-2 cells.
21959795 2012 Gefitinib resistance in HCC mahlavu cells: upregulation of CD133 expression, activation of IGF-1R signaling pathway, and enhancement of IGF-1R nuclear translocation.
21947321 2012 Hypoxia induces CD133 expression in human lung cancer cells by up-regulation of OCT3/4 and SOX2.
21937449 2011 CD133 protein N-glycosylation processing contributes to cell surface recognition of the primitive cell marker AC133 epitope.
21931765 2011 MiR-34a targeting of Notch ligand delta-like 1 impairs CD15+/CD133+ tumor-propagating cells and supports neural differentiation in medulloblastoma.
21917149 2011 Side population rather than CD133(+) cells distinguishes enriched tumorigenicity in hTERT-immortalized primary prostate cancer cells.
21912092 2011 Identification of CD133+ cells in pituitary adenomas.
21901757 2011 Expression and regulation of AC133 and CD133 in glioblastoma.
21900452 2012 Hypoxia modulates the undifferentiated phenotype of human renal inner medullary CD133+ progenitors through Oct4/miR-145 balance.
21898409 2012 CD133 and CD44 cell surface markers do not identify cancer stem cells in primary human gastric tumors.
21868340 2011 [Expressions of OCT4 and CD133 and their correlation in colonic cancer].
21829201 2011 Sequential expression of putative stem cell markers in gastric carcinogenesis.
21826669 2011 Identification of Endothelin-1 and NR4A2 as CD133-regulated genes in colon cancer cells.
21808992 2012 Circulating CD133(+)VEGFR2 (+) and CD34 (+)VEGFR2 (+) cells and arterial function in patients with beta-thalassaemia major.
21801380 2011 Regulation of the stem cell marker CD133 is independent of promoter hypermethylation in human epithelial differentiation and cancer.
21798073 2011 CD133: a potential indicator for differentiation and prognosis of human cholangiocarcinoma.
21778785 2011 Hypoxia induces tumor aggressiveness and the expansion of CD133-positive cells in a hypoxia-inducible factor-1?-dependent manner in pancreatic cancer cells.
21764578 2012 Co-expression of stem cell genes CD133 and CD44 in colorectal cancers with early liver metastasis.
21695188 2011 ALDH activity selectively defines an enhanced tumor-initiating cell population relative to CD133 expression in human pancreatic adenocarcinoma.
21602936 2011 CD133 positive embryonal rhabdomyosarcoma stem-like cell population is enriched in rhabdospheres.
21591261 2011 Haematopoietic stem cell differentiation promotes the release of prominin-1/CD133-containing membrane vesicles--a role of the endocytic-exocytic pathway.
21559522 2011 Human CD34+ CD133+ hematopoietic stem cells cultured with growth factors including Angptl5 efficiently engraft adult NOD-SCID Il2r?-/- (NSG) mice.
21508381 2011 Prognostic impact of CD133 immunoexpression in node-negative invasive breast carcinomas.
21486962 2011 High levels of PROM1 (CD133) transcript are a potential predictor of poor prognosis in medulloblastoma.
21479688 2011 Prognostic impact of CD133 mRNA expression in 48 glioblastoma patients treated with concomitant radiochemotherapy: a prospective patient cohort at a single institution.
21462307 High CD133 expression levels in gastrointestinal stromal tumors.
21457403 2011 CD133 is a marker of gland-forming cells in gastric tumors and Sox17 is involved in its regulation.
21448425 2011 Strong expression of CD133 is associated with increased cholangiocarcinoma progression.
21438906 2011 CD133 expression is associated with small round blue cell tumour morphology in human central nervous system neoplasms.
21436631 2011 A gene signature distinguishing CD133hi from CD133- colorectal cancer cells: essential role for EGR1 and downstream factors.
21435437 2011 Genome and transcriptome profiles of CD133-positive colorectal cancer cells.
21415057 2011 Clinicopathological significance and prognostic value of EphA3 and CD133 expression in colorectal carcinoma.
21412503 2011 Upregulated CD133 expression in tumorigenesis of colon cancer cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21385990 2011 Human primary bone sarcomas contain CD133+ cancer stem cells displaying high tumorigenicity in vivo.
21372740 2011 Myocardial blood flow and infarct size after CD133+ cell injection in large myocardial infarction with good recanalization and poor reperfusion: results from a randomized controlled trial.
21360712 2011 Is CD133 mRNA expression a prognostic factor in colorectal cancer?
21331808 2011 Elevated expression of the stem cell marker CD133 associated with Line-1 demethylation in hepatocellular carcinoma.
21304102 2011 Dendritic cells with lymphocyte-stimulating activity differentiate from human CD133 positive precursors.
21276138 2011 Clinicopathological significance and prognostic value of CD133 expression in triple-negative breast carcinoma.
21238532 2011 Identification and isolation from either adult human bone marrow or G-CSF-mobilized peripheral blood of CD34(+)/CD133(+)/CXCR4(+)/ Lin(-)CD45(-) cells, featuring morphological, molecular, and phenotypic characteristics of very small embryonic-like (VSEL) stem cells.
21220328 2011 A CD133-related gene expression signature identifies an aggressive glioblastoma subtype with excessive mutations.
21187924 2010 Non-invasive in vivo imaging of tumor-associated CD133/prominin.
21174061 2011 CD133 is a temporary marker of cancer stem cells in small cell lung cancer, but not in non-small cell lung cancer.
21127401 2010 Differential role of CD133 and CXCR4 in renal cell carcinoma.
21122138 2010 Epigenetic regulation of CD133 and tumorigenicity of CD133 positive and negative endometrial cancer cells.
21082674 2010 Comprehensive analysis of low-abundance proteins in human urinary exosomes using peptide ligand library technology, peptide OFFGEL fractionation and nanoHPLC-chip-MS/MS.
21082235 2011 Identification of CD133(-)/telomerase(low) progenitor cells in glioblastoma-derived cancer stem cell lines.
21064103 2011 Expression profiling of GIST: CD133 is associated with KIT exon 11 mutations, gastric location and poor prognosis.
21054902 2010 Expressions and clinical significances of CD133 protein and CD133 mRNA in primary lesion of gastric adenocacinoma.
20970309 2011 Clinical significance of CD133 and hypoxia inducible factor-1? gene expression in rectal cancer after preoperative chemoradiotherapy.
20878131 2010 Analysis of stemness gene expression and CD133 abnormal methylation in neuroblastoma cell lines.
20872808 2010 CD133 mRNA expression and microsatellite instability in colorectal carcinoma.
20859302 2011 Extended extraocular phenotype of PROM1 mutation in kindreds with known autosomal dominant macular dystrophy.
20854168 2011 SDF-1? secreted by human CD133-derived multipotent stromal cells promotes neural progenitor cell survival through CXCR7.
20853315 2011 Insight into the complex regulation of CD133 in glioma.
20818439 2011 CD133 suppresses neuroblastoma cell differentiation via signal pathway modification.
20800872 2010 Prognostic impact of CD133 expression as a tumor-initiating cell marker in endometrial cancer.
20800650 2010 Overexpression of CD133 promotes the phosphorylation of Erk in U87MG human glioblastoma cells.
20717901 2011 Prominin-1 (CD133) is not restricted to stem cells located in the basal compartment of murine and human prostate.
20717756 2011 The combination of stem cell markers CD133 and ABCG2 predicts relapse in stage I non-small cell lung carcinomas.
20711432 2010 Prospectively isolated cancer-associated CD10(+) fibroblasts have stronger interactions with CD133(+) colon cancer cells than with CD133(-) cancer cells.
20707712 2010 A genome-wide association study of self-rated health.
20617370 2010 CD133(+) single cell-derived progenies of colorectal cancer cell line SW480 with different invasive and metastatic potential.
20606680 2010 Prognostic impact of the expression of putative cancer stem cell markers CD133, CD166, CD44s, EpCAM, and ALDH1 in colorectal cancer.
20596619 2010 Immunohistochemical features of CD133 expression: association with resistance to chemoradiotherapy in rectal cancer.
20593500 2010 Promoter hypermethylation and loss of CD133 gene expression in colorectal cancers.
20587144 2010 Characteristics of CD133(+) human colon cancer SW620 cells.
20564348 2010 Members of the low-density lipoprotein receptor-related proteins provide a differential molecular signature between parental and CD133+ DAOY medulloblastoma cells.
20560029 2010 COMPARE-AMI trial: comparison of intracoronary injection of CD133+ bone marrow stem cells to placebo in patients after acute myocardial infarction and left ventricular dysfunction: study rationale and design.
20551139 2010 Alpha2,3-Sialylation regulates the stability of stem cell marker CD133.
20530554 2010 Activation of Akt and MAPK pathways enhances the tumorigenicity of CD133+ primary colon cancer cells.
20530428 2010 Demethylation of the CD133 gene is frequently detected in early gastric carcinoma.
20526812 2011 CD133+ CD44+ subgroups may be human small intestinal stem cells.
20502714 2010 The stem cell marker CD133 associates with enhanced colony formation and cell motility in colorectal cancer.
20487522 2010 Aberrant expression of CD133 protein correlates with Ki-67 expression and is a prognostic marker in gastric adenocarcinoma.
20428792 2010 Glioblastoma cells negative for the anti-CD133 antibody AC133 express a truncated variant of the CD133 protein.
20395004 2010 Expression of CD133 confers malignant potential by regulating metalloproteinases in human hepatocellular carcinoma.
20393116 2010 The PROM1 mutation p.R373C causes an autosomal dominant bull's eye maculopathy associated with rod, rod-cone, and macular dystrophy.
20379837 2010 CD133 expression is a potential prognostic indicator in intrahepatic cholangiocarcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20347795 Intracoronary infusion of CD133+ endothelial progenitor cells improves heart function and quality of life in patients with chronic post-infarct heart insufficiency.
20346143 2010 CD133 expression in chemo-resistant Ewing sarcoma cells.
20333645 2010 Post-translational modulation of CD133 expression during sodium butyrate-induced differentiation of HT29 human colon cancer cells: implications for its detection.
20309962 2010 Intratumoral hypoxic gradient drives stem cells distribution and MGMT expression in glioblastoma.
20196115 2010 Epigenetic regulation of cancer stem cell marker CD133 by transforming growth factor-beta.
20181261 2010 CD133, CD15/SSEA-1, CD34 or side populations do not resume tumor-initiating properties of long-term cultured cancer stem cells from human malignant glio-neuronal tumors.
20167130 2010 Analysis of an alternative human CD133 promoter reveals the implication of Ras/ERK pathway in tumor stem-like hallmarks.
20081809 2010 CD133 expression predicts for non-response to chemotherapy in colorectal cancer.
20068153 2010 The AC133 epitope, but not the CD133 protein, is lost upon cancer stem cell differentiation.
20062010 2010 Expression of CD133+ cancer stem cells in childhood malignant melanoma and its correlation with metastasis.
20056076 2010 [Generation and preliminary functional study of a CD133-2-harboring L929 cell line].
20042663 2010 Autosomal recessive retinitis pigmentosa with early macular affectation caused by premature truncation in PROM1.
20023382 2010 Expression of CD133 correlates with differentiation of human colon cancer cells.
19940551 2009 Isolation and characterization of spheroid cells from human malignant melanoma cell line WM-266-4.
19904829 2010 NOTCH pathway blockade depletes CD133-positive glioblastoma cells and inhibits growth of tumor neurospheres and xenografts.
19842219 2009 Characterization of CD133+ parenchymal cells in the liver: histology and culture.
19816957 2009 CD133 expression defines a tumor initiating cell population in primary human ovarian cancer.
19805294 2009 Highly tumorigenic lung cancer CD133+ cells display stem-like features and are spared by cisplatin treatment.
19786935 2009 CD133 expression pattern distinguishes intraductal papillary mucinous neoplasms from ductal adenocarcinomas of the pancreas.
19760928 CD133 gene overexpression is frequently observed in early colorectal carcinoma.
19752721 2010 Expression of CD133 in synovial sarcoma.
19744348 2009 CD133-positive hepatocellular carcinoma in an area endemic for hepatitis B virus infection.
19724856 2009 Effect of CD133/prominin-1 antisense oligodeoxynucleotide on in vitro growth characteristics of Huh-7 human hepatocarcinoma cells and U251 human glioma cells.
19724847 2009 Elevated CD133, but not VEGF or EGFR, as a predictive marker of distant recurrence after preoperative chemoradiotherapy in rectal cancer.
19723143 2009 Cancer stem cell marker CD133+ tumour cells and clinical outcome in rectal cancer.
19718438 2009 Glioblastoma formation from cell population depleted of Prominin1-expressing cells.
19718270 2009 Cone-rod dystrophy and a frameshift mutation in the PROM1 gene.
19676044 2010 CD133 is indicative for a resistance phenotype but does not represent a prognostic marker for survival of non-small cell lung cancer patients.
19657699 2009 Correlation of CD133, OCT4, and SOX2 in rectal cancer and their association with distant recurrence after chemoradiotherapy.
19626493 2009 Prognostic significance of the cancer stem cell markers CD133, CD44, and CD166 in colorectal cancer.
19621338 2009 The cancer stem cell marker CD133 has high prognostic impact but unknown functional relevance for the metastasis of human colon cancer.
19584075 2009 Novel susceptibility loci for second primary tumors/recurrence in head and neck cancer patients: large-scale evaluation of genetic variants.
19583859 2009 CD133 antigen expression in ovarian cancer.
19583834 2009 Higher percentage of CD133+ cells is associated with poor prognosis in colon carcinoma patients with stage IIIB.
19509143 2009 Cells with characteristics of cancer stem/progenitor cells express the CD133 antigen in human endometrial tumors.
19430532 2009 CD133 (Prominin) negative human neural stem cells are clonogenic and tripotent.
19404394 2009 CD133+ anaplastic thyroid cancer cells initiate tumors in immunodeficient mice and are regulated by thyrotropin.
19385971 2009 Both CD133+ and CD133- subpopulations of A549 and H446 cells contain cancer-initiating cells.
19384922 2009 ABCB1 is predominantly expressed in human fetal neural stem/progenitor cells at an early development stage.
19369008 2009 How powerful is CD133 as a cancer stem cell marker in brain tumors?
19342601 2009 Human CD133+ progenitor cells promote the healing of diabetic ischemic ulcers by paracrine stimulation of angiogenesis and activation of Wnt signaling.
19302789 2009 Release of extracellular membrane vesicles from microvilli of epithelial cells is enhanced by depleting membrane cholesterol.
19216024 2009 The first extracellular domain of the tumour stem cell marker CD133 contains an antigenic ganglioside-binding motif.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19190083 2009 Characterization of exosome-like vesicles released from human tracheobronchial ciliated epithelium: a possible role in innate defense.
19153665 2009 CD20-related signaling pathway is differently activated in normal and dystrophic circulating CD133(+) stem cells.
19147788 2009 Expression of CD133 on leukemia-initiating cells in childhood ALL.
19092120 2009 Regeneration of glomerular podocytes by human renal progenitors.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19047148 2008 The role of CD133 in normal human prostate stem cells and malignant cancer-initiating cells.
19017033 2009 Involvement of vascular endothelial growth factor, CD44 and CD133 in periodontal disease and diabetes: an immunohistochemical study.
18985161 2008 CD133 is a marker of bioenergetic stress in human glioma.
18853445 2009 In vivo investigation of CD133 as a putative marker of cancer stem cells in Hep-2 cell line.
18836486 2009 Epigenetic regulation of CD133 and tumorigenicity of CD133+ ovarian cancer cells.
18829568 2008 Abnormal DNA methylation of CD133 in colorectal and glioblastoma tumors.
18829544 2008 Cell cycle-dependent variation of a CD133 epitope in human embryonic stem cell, colon cancer, and melanoma cell lines.
18802032 2008 The stem cell-associated antigen CD133 (Prominin-1) is a molecular therapeutic target for metastatic melanoma.
18781171 2008 CD133 expression is an independent prognostic marker for low survival in colorectal cancer.
18754869 2008 Immunohistochemical detection of CD133 expression in colorectal cancer: a clinicopathological study.
18702870 2008 CD133-2 (AC141) expression analysis in acute leukemia immunophenotyping in correlation to CD34 and P-glycoprotein.
18679414 2008 Promoter hypomethylation regulates CD133 expression in human gliomas.
18654668 2008 Mutant prominin 1 found in patients with macular degeneration disrupts photoreceptor disk morphogenesis in mice.
18645205 2008 The stem cell marker CD133 (Prominin-1) is expressed in various human glandular epithelia.
18644979 2008 Aldehyde dehydrogenase discriminates the CD133 liver cancer stem cell populations.
18602031 2008 Methylation of the prominin 1 TATA-less main promoters and tissue specificity of their transcript content.
18568776 2008 Expression of multidrug resistance genes in normal and cancer stem cells.
18542072 2008 CD133/prominin-1 is a potential therapeutic target for antibody-drug conjugates in hepatocellular and gastric cancers.
18511311 The stem cell marker CD133 meets the endosomal compartment--new insights into the cell division of hematopoietic stem cells.
18497883 2008 Is CD133 a marker of metastatic colon cancer stem cells?
18410526 2009 Endothelial cells from cord blood CD133+CD34+ progenitors share phenotypic, functional and gene expression profile similarities with lymphatics.
18403755 2008 Direct orthotopic transplantation of fresh surgical specimen preserves CD133+ tumor cells in clinically relevant mouse models of medulloblastoma and glioma.
18402255 2008 Expression and clinical significance of stem cell marker CD133 in human neuroblastoma.
18398820 2008 Expression profiling of CD133+ and CD133- epithelial cells from human prostate.
18398462 2008 Glial progenitor-like phenotype in low-grade glioma and enhanced CD133-expression and neuronal lineage differentiation potential in high-grade glioma.
18374086 2008 Differentiation of CD133-positive pancreatic cells into insulin-producing islet-like cell clusters.
18371181 2008 CD133 expression and cancer stem cells predict prognosis in high-grade oligodendroglial tumors.
18192867 2008 Stem cell marker prominin-1/AC133 is expressed in duct cells of the adult human pancreas.
18172261 2008 Stem cell marker CD133 affects clinical outcome in glioma patients.
18096722 2008 The stem cell marker prominin-1/CD133 on membrane particles in human cerebrospinal fluid offers novel approaches for studying central nervous system disease.
17999603 2007 The neurotransmitter GABA is a potent inhibitor of the stromal cell-derived factor-1alpha induced migration of adult CD133+ hematopoietic stem and progenitor cells.
17977646 2007 Influence of oxygen tension on CD133 phenotype in human glioma cell cultures.
17912948 2007 Autologous transplantation of muscle-derived CD133+ stem cells in Duchenne muscle patients.
17883595 2007 Elevated tissue factor procoagulant activity in CD133-positive cancer cells.
17874118 2007 Differential expression of Prominin-1 (CD133) and Prominin-2 in major cephalic exocrine glands of adult mice.
17868344 Expression of CD133-1 and CD133-2 in ovarian cancer.
17785371 2007 Novel germ cell markers characterize testicular seminoma and fetal testis.
17605847 2007 [Expression of CD133 in bone marrow cells of patients with leukemia and myelodysplastic syndrome].
17605048 2007 Severe retinitis pigmentosa mapped to 4p15 and associated with a novel mutation in the PROM1 gene.
17594720 2007 Elevated circulating endothelial progenitor marker CD133 messenger RNA levels predict colon cancer recurrence.
17545092 2007 [Association of CD133 and endothelin-converting enzyme expressions with prognosis of non-small cell lung carcinoma].
17498271 2007 Nomenclature of prominin-1 (CD133) splice variants - an update.
17487431 2007 Comparative genomics on PROM1 gene encoding stem cell marker CD133.
17388661 2007 Exquisite sensitivity of TP53 mutant and basal breast cancers to a dose-dense epirubicin-cyclophosphamide regimen.
17253947 2006 Transcriptional profiling reflects shared and unique characters for CD34+ and CD133+ cells.
17205516 2007 CD133 positive hepatocellular carcinoma cells possess high capacity for tumorigenicity.
17122772 2007 A human colon cancer cell capable of initiating tumour growth in immunodeficient mice.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17077937 2007 Expression of MHC I and NK ligands on human CD133+ glioma cells: possible targets of immunotherapy.
17077324 2007 Endolyn (CD164) modulates the CXCL12-mediated migration of umbilical cord blood CD133+ cells.
16914572 2006 Progenitor marker CD133 mRNA is elevated in peripheral blood of cancer patients with bone metastases.
16885410 2006 Isolation and characterization of multipotent progenitor cells from the Bowman's capsule of adult human kidneys.
16809613 2006 VCAM-1 expression on dystrophic muscle vessels has a critical role in the recruitment of human blood-derived CD133+ stem cells after intra-arterial transplantation.
16502470 2006 Human colostrum: identification of minor proteins in the aqueous phase by proteomics.
16439688 2006 CD34-/CD133+/VEGFR-2+ endothelial progenitor cell subpopulation with potent vasoregenerative capacities.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15558321 2005 Prominin-1/CD133, a neural and hematopoietic stem cell marker, is expressed in adult human differentiated cells and certain types of kidney cancer.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15254585 2004 Human circulating AC133(+) stem cells restore dystrophin expression and ameliorate function in dystrophic skeletal muscle.
15231568 2004 Segregation of lipid raft markers including CD133 in polarized human hematopoietic stem and progenitor cells.
15226377 2004 CD133, a novel marker for human prostatic epithelial stem cells.
15115691 2004 Cell cycle analysis of the CD133+ and CD133- cells isolated from umbilical cord blood.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14630820 2004 Alternative promoters regulate transcription of the gene that encodes stem cell surface protein AC133.
12799292 2003 Biology and plasticity of CD133+ hematopoietic stem cells.
12657606 2003 An autosomal dominant bull's-eye macular dystrophy (MCDR2) that maps to the short arm of chromosome 4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12042327 2002 AC133-2, a novel isoform of human AC133 stem cell antigen.
11467842 2001 Rat prominin, like its mouse and human orthologues, is a pentaspan membrane glycoprotein.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10587575 2000 A frameshift mutation in prominin (mouse)-like 1 causes human retinal degeneration.
10205271 1999 A new locus for autosomal dominant stargardt-like disease maps to chromosome 4.
10075457 1999 Expression of AC133, a novel hematopoietic precursor antigen, on acute myeloid leukemia cells.
9389721 1997 A novel five-transmembrane hematopoietic stem cell antigen: isolation, characterization, and molecular cloning.
9389720 1997 AC133, a novel marker for human hematopoietic stem and progenitor cells.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.