Property Summary

NCBI Gene PubMed Count 52
PubMed Score 49.29
PubTator Score 68.90

Knowledge Summary

Patent (14,366)

Expression

Gene RIF (50)

AA Sequence

MAAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIVIGIALAGIMLVCGIG      1 - 70
NFVFIAALTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLSWEHGHVLCASVNYLRTVSLY     71 - 140
VSTNALLAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMVSILIAIPSAYFATETVLFIVKSQEKIFCGQ    141 - 210
IWPVDQQLYYKSYFLFIFGVEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCI    211 - 280
LTAYVLCWAPFYGFTIVRDFFPTVFVKEKHYLTAFYVVECIAMSNSMINTVCFVTVKNNTMKYFKKMMLL    281 - 350
HWRPSQRGSKSSADLDLRTNGVPTTEEVDCIRLK                                        351 - 384
//

Text Mined References (56)

PMID Year Title