Property Summary

Ligand Count 2
NCBI Gene PubMed Count 52
PubMed Score 49.29
PubTator Score 68.90

Knowledge Summary

Patent (14,366)


Gene RIF (50)

AA Sequence

HWRPSQRGSKSSADLDLRTNGVPTTEEVDCIRLK                                        351 - 384

Text Mined References (56)

PMID Year Title