Property Summary

NCBI Gene PubMed Count 49
PubMed Score 42.72
PubTator Score 68.90

Knowledge Summary

Patent (14,366)

Gene RIF (47)

PMID Text
26956854 PROKR2 may play a role in susceptibility of pituitary stalk interruption syndrome
26574895 Data suggest that prokineticins (PROK1 and PROK2) and prokineticin receptors (PROKR1 and PROKR2) act as main regulators of physiological functions of ovary, uterus, placenta, and testis. [REVIEW]
26192875 PROKR2 expression in human fetal ovary remained unchanged throughout gestation.
26047640 EG-VEGF, BV8, and PROKR2 gene expression is approximately five, four, and two times higher in cystic fibrosis lungs compared with controls.
25449422 PKR2 protomers form type II dimers involving TMs 4 and 5, with a role for TM5 in modulation of PKR2 function.
25064403 Study corroborates the clinical relevance of the EG-VEGF system in human early pregnancy, and provides evidence for the gene-gene interactions of EG-VEGF and PROKR variants.
24830383 Wild-type PROKR2 activates different G-protein subtypes (Gq, Gs, and Gi/o) and recruits beta-arrestins. The effects of 9 missense mutations on these 2 processes showed that some mutations affected both or only one of them.
24509228 PK2-induced PKR2 endocytosis is GRK2- and clathrin-dependent, but beta-arrestin-independent.
24487590 TSHZ1 is a key regulator of mammalian olfactory bulb development and function and controls the expression of PROKR2.
24276467 Single PROKR2 missense allelic variants can either affect both cAMP and IP signaling pathways differently or selectively.
24031091 An unexpectedly large prevalence of PROKR2 mutations was found in Kallmann syndrome patients from the Maghreb.
23969157 the distal region of the IL3 region of PROKR2 may differentially influence receptor trafficking and G-protein coupling
23891065 Prokineticin (PK)1/PKR2-signalling pathway is involved in the regulation of the functional adequate capillarization in late pregnancy
23687280 V331M variant confers lower risk for recurrent miscarriage
23386640 The role of PROKR2 in the etiology of congenital hypopituitarism, septo-optic dysplasia, and Kallmann syndrome is uncertain.
23200691 PROKR2 signaling does not directly affect Sertoli cell function in autosomal recessive Kallmann syndrome.
23082007 Three PROKR2 mutations previously described in Kallmann syndrome and one new PROK2 mutation were found in patients with isolated congenital anosmia.
22773735 An ancient founder missense mutation in PROKR2 impairs human reproduction.
22745195 The R80C mutant of PROKR2 exerts a dominant negative effect on wild type PROKR2 by interfering with wild type receptor expression.
22466334 We report PROKR2 variants in congenital hypopituitarism with pituitary stalk interruption, suggesting a potential role of the prokineticin pathway in pituitary development.
22319038 genetic association studies in 103 patients from US and UK: Mutations in PROKR2, FGFR1, or FGF8 contributed to 7.8% of patients with combined pituitary hormone deficiency or septo-optic dysplasia. Data suggest genetic overlap with Kallmann syndrome.
22138749 hCG increases EG-VEGF, PROKR1 and PROKR2 mRNA and protein expression in a dose- and time-dependent manner, demonstrating a new role for hCG in the regulation of EG-VEGF and its receptors
22132188 The results suggest an identical transmembrane-bundle binding site for hPKR1 and hPKR2.
21858136 Findings, together with the detection of sequence variants in PROKR1, PROK1 and PROKR2 genes associated to HSCR and, in some cases in combination with RET or GDNF mutations, provide evidence to consider them as susceptibility genes for HSCR.
21454486 positive charges in the second intracellular loop mutations of the PKR2 receptor have roles in G-protein coupling and receptor trafficking
21224062 ligation of tubal TLR2 and activation of NFkappaB by C. trachomatis leads to increased tubal PROKR2, thereby predisposing the tubal microenvironment to ectopic implantation.
20847187 one tag SNP of PKR2 (rs6053283) was significantly associated with idiopathic recurrent pregnancy loss.
20847187 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20734064 Observational study of gene-disease association. (HuGE Navigator)
20576534 PROKR2 may play a role in the pathophysiology of methamphetamine dependence in the Japanese population.
20576534 Observational study of gene-disease association. (HuGE Navigator)
20389090 Patients with this genetic form of Kallmann syndrome have been reported to have a possible increased prevalence of obesity and sleep disorders, which may be related to the role of PROKR2 in food intake and circadian rhythms (Review)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20023120 The functional characteristics of coronary endothelial cells depend on the expression of PKR1 and PKR2 levels and the divergent signaling pathways used by these receptors.
20022991 Male patients carrying biallelic mutations in PROK2 or PROKR2 have a less variable and on average a more severe reproductive phenotype than patients carrying monoallelic mutations in these genes.
20022991 Observational study of gene-disease association. (HuGE Navigator)
19544013 Results suggest that PROKR2 may play a role in the pathophysiology of mood disorders in the Japanese population.
18826963 In Kallmann syndrome patients, ten different missense mutations have been identified in PROKR2.
18723471 Two Kallmann syndrome patients presented a heterozygous T-to-G transversion in exon 2 (c.518T>G).
18723471 Observational study of gene-disease association. (HuGE Navigator)
18682503 Loss-of-function mutations in the genes encoding prokineticin-2 or prokineticin receptor-2 cause autosomal recessive Kallmann syndrome.
18682503 Observational study of gene-disease association. (HuGE Navigator)
18559922 Loss-of-function mutations in PROK2 and PROKR2 underlie both Kallmann syndrome (KS) and normosmic idiopathic hypogonadotropic hypogonadism (IHH).
17054399 These findings reveal that insufficient prokineticin-signaling through PROKR2 leads to abnormal development of the olfactory system and reproductive axis in man.
16763065 study demonstrated that prokineticin 1 and 2 and their receptors are expressed in human prostate and that their levels increased with prostate malignancy
15126578 Paracrine role for the PKs and their receptors in endometrial vascular function.
12427552 molecular cloning, amino acid sequence and expression in several human tissues

AA Sequence

MAAQNGNTSFTPNFNPPQDHASSLSFNFSYGDYDLPMDEDEDMTKTRTFFAAKIVIGIALAGIMLVCGIG      1 - 70
NFVFIAALTRYKKLRNLTNLLIANLAISDFLVAIICCPFEMDYYVVRQLSWEHGHVLCASVNYLRTVSLY     71 - 140
VSTNALLAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMVSILIAIPSAYFATETVLFIVKSQEKIFCGQ    141 - 210
IWPVDQQLYYKSYFLFIFGVEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRRKTVLVLMCI    211 - 280
LTAYVLCWAPFYGFTIVRDFFPTVFVKEKHYLTAFYVVECIAMSNSMINTVCFVTVKNNTMKYFKKMMLL    281 - 350
HWRPSQRGSKSSADLDLRTNGVPTTEEVDCIRLK                                        351 - 384
//

Text Mined References (52)

PMID Year Title
26956854 2016 Correlation between Pituitary Stalk Interruption Syndrome and Prokineticin Receptor 2 and Prokineticin 2 Mutations.
26574895 2015 Prokineticins in central and peripheral control of human reproduction.
26192875 2015 Prokineticin Ligands and Receptors Are Expressed in the Human Fetal Ovary and Regulate Germ Cell Expression of COX2.
26047640 2015 EG-VEGF, BV8, and their receptor expression in human bronchi and their modification in cystic fibrosis: Impact of CFTR mutation (delF508).
25449422 2015 Identification of transmembrane domains that regulate spatial arrangements and activity of prokineticin receptor 2 dimers.
25077900 2014 The prevalence of CHD7 missense versus truncating mutations is higher in patients with Kallmann syndrome than in typical CHARGE patients.
25064403 2014 Gene-gene interactions and risk of recurrent miscarriages in carriers of endocrine gland-derived vascular endothelial growth factor and prokineticin receptor polymorphisms.
24830383 2014 Biased signaling through G-protein-coupled PROKR2 receptors harboring missense mutations.
24509228 2014 Mechanisms that underlie the internalization and extracellular signal regulated kinase 1/2 activation by PKR2 receptor.
24487590 2014 TSHZ1-dependent gene regulation is essential for olfactory bulb development and olfaction.
24276467 2014 Germline prokineticin receptor 2 (PROKR2) variants associated with central hypogonadism cause differental modulation of distinct intracellular pathways.
24031091 2013 Greater prevalence of PROKR2 mutations in Kallmann syndrome patients from the Maghreb than in European patients.
23969157 2013 Functional analysis of the distal region of the third intracellular loop of PROKR2.
23891065 2013 Imbalance of expression of bFGF and PK1 is associated with defective maturation and antenatal placental insufficiency.
23687280 2013 Prokineticin receptor variants (PKR1-I379V and PKR2-V331M) are protective genotypes in human early pregnancy.
23643382 2013 Mutations in FGF17, IL17RD, DUSP6, SPRY4, and FLRT3 are identified in individuals with congenital hypogonadotropic hypogonadism.
23386640 2013 Variations in PROKR2, but not PROK2, are associated with hypopituitarism and septo-optic dysplasia.
23200691 2013 PROKR2 mutations in autosomal recessive Kallmann syndrome.
23082007 2013 PROKR2 and PROK2 mutations cause isolated congenital anosmia without gonadotropic deficiency.
22927827 2012 SEMA3A, a gene involved in axonal pathfinding, is mutated in patients with Kallmann syndrome.
22773735 2012 An ancient founder mutation in PROKR2 impairs human reproduction.
22745195 2012 Evidence of the importance of the first intracellular loop of prokineticin receptor 2 in receptor function.
22466334 2012 PROKR2 variants in multiple hypopituitarism with pituitary stalk interruption.
22319038 2012 Genetic overlap in Kallmann syndrome, combined pituitary hormone deficiency, and septo-optic dysplasia.
22138749 2012 Revisiting the role of hCG: new regulation of the angiogenic factor EG-VEGF and its receptors.
22132188 2011 Modeling of human prokineticin receptors: interactions with novel small-molecule binders and potential off-target drugs.
21858136 2011 Expression of PROKR1 and PROKR2 in human enteric neural precursor cells and identification of sequence variants suggest a role in HSCR.
21454486 2011 Disease-causing mutation in PKR2 receptor reveals a critical role of positive charges in the second intracellular loop for G-protein coupling and receptor trafficking.
21224062 2011 Chlamydia trachomatis infection increases fallopian tube PROKR2 via TLR2 and NF?B activation resulting in a microenvironment predisposed to ectopic pregnancy.
21161321 2011 Evidence that prokineticin receptor 2 exists as a dimer in vivo.
20847187 2010 Polymorphisms of endocrine gland-derived vascular endothelial growth factor gene and its receptor genes are associated with recurrent pregnancy loss.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20576534 2010 PROKR2 is associated with methamphetamine dependence in the Japanese population.
20389090 2010 Kallmann syndrome caused by mutations in the PROK2 and PROKR2 genes: pathophysiology and genotype-phenotype correlations.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20023120 2010 Divergent roles of prokineticin receptors in the endothelial cells: angiogenesis and fenestration.
20022991 2010 A comparative phenotypic study of kallmann syndrome patients carrying monoallelic and biallelic mutations in the prokineticin 2 or prokineticin receptor 2 genes.
19544013 2009 Possible association of prokineticin 2 receptor gene (PROKR2) with mood disorders in the Japanese population.
18826963 2009 PROKR2 missense mutations associated with Kallmann syndrome impair receptor signalling activity.
18723471 Genetic analysis in patients with Kallmann syndrome: coexistence of mutations in prokineticin receptor 2 and KAL1.
18682503 2008 Loss-of-function mutations in the genes encoding prokineticin-2 or prokineticin receptor-2 cause autosomal recessive Kallmann syndrome.
18559922 2008 Mutations in prokineticin 2 and prokineticin receptor 2 genes in human gonadotrophin-releasing hormone deficiency: molecular genetics and clinical spectrum.
17054399 2006 Kallmann syndrome: mutations in the genes encoding prokineticin-2 and prokineticin receptor-2.
16763065 2006 The endocrine-gland-derived vascular endothelial growth factor (EG-VEGF)/prokineticin 1 and 2 and receptor expression in human prostate: Up-regulation of EG-VEGF/prokineticin 1 with malignancy.
16754659 2006 Stable association between G alpha(q) and phospholipase C beta 1 in living cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15126578 2004 Expression and regulation of the prokineticins (endocrine gland-derived vascular endothelial growth factor and Bv8) and their receptors in the human endometrium across the menstrual cycle.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12427552 2002 Molecular cloning and characterization of prokineticin receptors.
11886876 2002 Identification and molecular characterization of two closely related G protein-coupled receptors activated by prokineticins/endocrine gland vascular endothelial growth factor.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.