Property Summary

NCBI Gene PubMed Count 27
PubMed Score 20.48
PubTator Score 23.95

Knowledge Summary

Patent (7,704)

TINX Plot

  Disease (2)

Disease Target Count
Hyperalgesia 71
Pain 70
Disease Target Count Z-score Confidence
Ectopic pregnancy 16 3.89 1.9

Expression

Gene RIF (19)

PMID Text
26574895 Data suggest that prokineticins (PROK1 and PROK2) and prokineticin receptors (PROKR1 and PROKR2) act as main regulators of physiological functions of ovary, uterus, placenta, and testis. [REVIEW]
26475302 EG-VEGF and its receptor PKR1 might play a role in the pathogenesis of adrenocortical tumors and could serve as prognostic markers for this rare malignant disease.
26192875 Expression of PROK1 and PROKR1 was significantly higher in mid-gestation ovaries (17-20 wk) than at earlier gestations (8-11 and 14-16 wk).
25064403 Study corroborates the clinical relevance of the EG-VEGF system in human early pregnancy, and provides evidence for the gene-gene interactions of EG-VEGF and PROKR variants.
23687280 I397V variant confers lower risk for recurrent miscarriage
22138749 hCG increases EG-VEGF, PROKR1 and PROKR2 mRNA and protein expression in a dose- and time-dependent manner, demonstrating a new role for hCG in the regulation of EG-VEGF and its receptors
22132188 The results suggest an identical transmembrane-bundle binding site for hPKR1 and hPKR2.
21876489 The number of PKR1 is not reduced in preeclampsia.
21858136 Findings, together with the detection of sequence variants in PROKR1, PROK1 and PROKR2 genes associated to HSCR and, in some cases in combination with RET or GDNF mutations, provide evidence to consider them as susceptibility genes for HSCR.
20864676 Data suggest that smoking targets human Fallopian tubes via nAChRalpha-7 to increase tubal PROKR1, leading to alterations in the tubal microenvironment that could predispose to ectopic pregnancy.
20847187 Two tag SNPs of PKR1 (rs4627609, rs6731838) were significantly associated with idiopathic recurrent pregnancy loss.
20847187 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20795791 Data show that expression of PK1 and PKR1 was detected in primary MM cells and myeloma cell lines.
20023120 The functional characteristics of coronary endothelial cells depend on the expression of PKR1 and PKR2 levels and the divergent signaling pathways used by these receptors.
19801577 Data shown that PROK1-PROKR1 induces the expression of IL-11 in PROKR1 Ishikawa cells and first trimester decidua.
18339712 PROK1 and PROKR1 expression is elevated in human decidua during early pregnancy PROK1-PROKR1 interaction regulates expression of a host of implantation-related genes.
16763065 study demonstrated that prokineticin 1 and 2 and their receptors are expressed in human prostate and that their levels increased with prostate malignancy
15126578 Paracrine role for the PKs and their receptors in endometrial vascular function.
12427552 molecular cloning, amino acid sequence and expression in several human tissues

AA Sequence

METTMGFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFFAAKIVIGMALV      1 - 70
GIMLVCGIGNFIFIAALVRYKKLRNLTNLLIANLAISDFLVAIVCCPFEMDYYVVRQLSWEHGHVLCTSV     71 - 140
NYLRTVSLYVSTNALLAIAIDRYLAIVHPLRPRMKCQTATGLIALVWTVSILIAIPSAYFTTETVLVIVK    141 - 210
SQEKIFCGQIWPVDQQLYYKSYFLFIFGIEFVGPVVTMTLCYARISRELWFKAVPGFQTEQIRKRLRCRR    211 - 280
KTVLVLMCILTAYVLCWAPFYGFTIVRDFFPTVFVKEKHYLTAFYIVECIAMSNSMINTLCFVTVKNDTV    281 - 350
KYFKKIMLLHWKASYNGGKSSADLDLKTIGMPATEEVDCIRLK                               351 - 393
//

Text Mined References (27)

PMID Year Title
26984842 2016 Association between polymorphisms of prokineticin receptor (PKR1 rs4627609 and PKR2 rs6053283) and recurrent pregnancy loss.
26574895 2015 Prokineticins in central and peripheral control of human reproduction.
26475302 2015 Role of Endocrine Gland-Derived Vascular Endothelial Growth Factor (EG-VEGF) and Its Receptors in Adrenocortical Tumors.
26192875 2015 Prokineticin Ligands and Receptors Are Expressed in the Human Fetal Ovary and Regulate Germ Cell Expression of COX2.
25064403 2014 Gene-gene interactions and risk of recurrent miscarriages in carriers of endocrine gland-derived vascular endothelial growth factor and prokineticin receptor polymorphisms.
23687280 2013 Prokineticin receptor variants (PKR1-I379V and PKR2-V331M) are protective genotypes in human early pregnancy.
22138749 2012 Revisiting the role of hCG: new regulation of the angiogenic factor EG-VEGF and its receptors.
22132188 2011 Modeling of human prokineticin receptors: interactions with novel small-molecule binders and potential off-target drugs.
21876489 2011 The possible role of the PK1 and its receptor in the etiology of the preeclampsia.
21858136 2011 Expression of PROKR1 and PROKR2 in human enteric neural precursor cells and identification of sequence variants suggest a role in HSCR.
20864676 2010 Cotinine exposure increases Fallopian tube PROKR1 expression via nicotinic AChRalpha-7: a potential mechanism explaining the link between smoking and tubal ectopic pregnancy.
20847187 2010 Polymorphisms of endocrine gland-derived vascular endothelial growth factor gene and its receptor genes are associated with recurrent pregnancy loss.
20795791 2010 Prokineticin-1/endocrine gland-derived vascular endothelial growth factor is a survival factor for human multiple myeloma cells.
20023120 2010 Divergent roles of prokineticin receptors in the endothelial cells: angiogenesis and fenestration.
19801577 2010 Prokineticin-1 (PROK1) modulates interleukin (IL)-11 expression via prokineticin receptor 1 (PROKR1) and the calcineurin/NFAT signalling pathway.
18339712 2008 Prokineticin 1 signaling and gene regulation in early human pregnancy.
16763065 2006 The endocrine-gland-derived vascular endothelial growth factor (EG-VEGF)/prokineticin 1 and 2 and receptor expression in human prostate: Up-regulation of EG-VEGF/prokineticin 1 with malignancy.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
15126578 2004 Expression and regulation of the prokineticins (endocrine gland-derived vascular endothelial growth factor and Bv8) and their receptors in the human endometrium across the menstrual cycle.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12427552 2002 Molecular cloning and characterization of prokineticin receptors.
12054613 2002 Isolation and identification of EG-VEGF/prokineticins as cognate ligands for two orphan G-protein-coupled receptors.
11886876 2002 Identification and molecular characterization of two closely related G protein-coupled receptors activated by prokineticins/endocrine gland vascular endothelial growth factor.
10760605 2000 Y-receptor-like genes GPR72 and GPR73: molecular cloning, genomic organisation and assignment to human chromosome 11q21.1 and 2p14 and mouse chromosome 9 and 6.