Property Summary

NCBI Gene PubMed Count 46
PubMed Score 181.49
PubTator Score 146.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
interstitial cystitis 2.200 1.1e-03
intraductal papillary-mucinous adenoma (... -1.100 3.1e-02
lung adenocarcinoma -1.300 2.6e-09
medulloblastoma, large-cell 1.300 4.8e-02
non-small cell lung cancer -2.369 1.1e-16
osteosarcoma -2.518 3.8e-02
posterior fossa group B ependymoma 1.400 2.0e-04
psoriasis 1.200 7.0e-07
subependymal giant cell astrocytoma 1.494 1.3e-02
tuberculosis 1.500 2.5e-02
ulcerative colitis 3.700 1.3e-04

Gene RIF (36)

AA Sequence

MRSLCCAPLLLLLLLPPLLLTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHP      1 - 70
LTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK                71 - 129
//

Text Mined References (47)

PMID Year Title