Property Summary

NCBI Gene PubMed Count 5
PubMed Score 5.94
PubTator Score 4.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count
Schizophrenia 1160
Disease Target Count P-value
osteosarcoma 7950 1.2e-05
nephrosclerosis 333 2.6e-03
Rheumatoid arthritis 1191 2.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (3)

Disease log2 FC p
nephrosclerosis -1.817 2.6e-03
osteosarcoma 1.499 1.2e-05
Rheumatoid arthritis -1.100 2.6e-02

Gene RIF (4)

AA Sequence

MSPRVVSNSSVLASQSVGITNVRTVFSNVFNNTTAFPILRGSNCHKITAPGLGKGQLVNLLPPENLPWCG      1 - 70
GSQGPRMLRTCYVLCSQAGPPSRGWQSLSFDGGAFHLKGTGELTRALLVLRLCAWPPLVTHGLLLQAWSR     71 - 140
RLLGSRLSGAFLRASVYGQFVAGETAEEVKGCVQQLRTLSLRPLLAVPTEEEPDSAAKSGEAWYEGNLGA    141 - 210
MLRCVDLSRGLLEPPSLAEASLMQLKVTALTSTRLCKELASWVRRPGASLELSPERLAEAMDSGQNLQVS    211 - 280
CLNAEQNQHLRASLSRLHRVAQYARAQHVRLLVDAEYTSLNPALSLLVAALAVRWNSPGEGGPWVWNTYQ    281 - 350
ACLKDTFERLGRDAEAAHRAGLAFGVKLVRGAYLDKERAVAQLHGMEDPTQPDYEATSQSYSRCLELMLT    351 - 420
HVARHGPMCHLMVASHNEESVRQATKRMWELGIPLDGTVCFGQLLGMCDHVSLALGQAGYVVYKSIPYGS    421 - 490
LEEVIPYLIRRAQENRSVLQGARREQELLSQELWRRLLPGCRRIPH                            491 - 536
//

Text Mined References (5)

PMID Year Title