Property Summary

NCBI Gene PubMed Count 80
PubMed Score 779.28
PubTator Score 115.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (9)

Disease log2 FC p
cutaneous lupus erythematosus -1.700 1.5e-03
glioblastoma -1.300 1.5e-04
group 3 medulloblastoma -2.000 7.7e-06
lung carcinoma -1.400 6.9e-13
malignant mesothelioma 3.400 2.0e-06
medulloblastoma, large-cell -1.600 1.9e-05
pediatric high grade glioma -1.600 8.4e-05
psoriasis -1.400 3.1e-06
uncontrolled asthma 1.400 4.5e-03

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (64)

AA Sequence

MALRRALPALRPCIPRFVQLSTAPASREQPAAGPAAVPGGGSATAVRPPVPAVDFGNAQEAYRSRRTWEL      1 - 70
ARSLLVLRLCAWPALLARHEQLLYVSRKLLGQRLFNKLMKMTFYGHFVAGEDQESIQPLLRHYRAFGVSA     71 - 140
ILDYGVEEDLSPEEAEHKEMESCTSAAERDGSGTNKRDKQYQAHRAFGDRRNGVISARTYFYANEAKCDS    141 - 210
HMETFLRCIEASGRVSDDGFIAIKLTALGRPQFLLQFSEVLAKWRCFFHQMAVEQGQAGLAAMDTKLEVA    211 - 280
VLQESVAKLGIASRAEIEDWFTAETLGVSGTMDLLDWSSLIDSRTKLSKHLVVPNAQTGQLEPLLSRFTE    281 - 350
EEELQMTRMLQRMDVLAKKATEMGVRLMVDAEQTYFQPAISRLTLEMQRKFNVEKPLIFNTYQCYLKDAY    351 - 420
DNVTLDVELARREGWCFGAKLVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAK    421 - 490
AKVMVASHNEDTVRFALRRMEELGLHPADHQVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVMEVLPY    491 - 560
LSRRALENSSLMKGTHRERQLLWLELLRRLRTGNLFHRPA                                  561 - 600
//

Text Mined References (82)

PMID Year Title