Property Summary

NCBI Gene PubMed Count 168
PubMed Score 519.61
PubTator Score 371.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -3.200 1.6e-07
astrocytic glioma -1.200 4.1e-02
oligodendroglioma -1.100 4.6e-02
cystic fibrosis 1.030 2.5e-05
atypical teratoid / rhabdoid tumor 2.100 2.4e-02
intraductal papillary-mucinous neoplasm ... 1.400 8.0e-03
gastric carcinoma 1.700 1.4e-02
ductal carcinoma in situ -1.500 5.2e-03
invasive ductal carcinoma -1.400 2.8e-02
ovarian cancer -5.600 8.9e-20

 GO Function (1)

Protein-protein Interaction (7)

Gene RIF (145)

PMID Text
26620701 In this Tanzanian population, neither PROCR haplotype nor level of soluble EPCR was associated with severe malaria.
26119044 Overall, these findings reveal a much greater complexity of how Plasmodium falciparum PfEMP1 CIDRalpha1 domain-expressing parasites may modulate malaria pathogenesis through EPCR adhesion.
26118955 These data reveal a previously unknown functional heterogeneity in the interaction between Plasmodium falciparum PfEMP1 CIDRalpha1domain binding to EPCR and have major implications for understanding the distinct clinical pathologies of cerebral malaria.
26015475 Individuals exposed to high levels of Plasmodium falciparum PfEMP1 acquire antibodies to EPCR-binding CIDR domains early in life.
25895599 This effect of EPCR may be dependent on PAR1.
25667200 Report activation of protein C and down-regulation of EPCR in trophobolasts stimulated with TNF-alpha.
25588409 Serum soluble EPCR is elevated in Alzheimer's disease. The degree of cognitive impairment is significantly correlated with serum sEPCR levels in Alzheimer's disease and mild cognitive impairment patients and healthy controls.
25541704 genetic variation in the PROCR gene in our study population does not influence susceptibility to major severe malaria phenotypes
25425698 It was concluded that measuring EPCR levels at admission could provide an early biological marker of the outcome of cerebral malaria.
25407022 Increased coagulation activity and genetic polymorphisms in the F5, F10 and EPCR genes are associated with breast cancer.
25246042 Low PROCR mRNA expression levels associated with a poor prognosis in patients with disseminated intravascular coagulation (DIC) represents an exhaustion of the natural anticoagulant system, and reflects the final decompensate stage of DIC.
24862151 Blocking antibodies to EPCR attenuate in vivo tumor growth and proliferation specifically of EPCR(+) cells on defined integrin matrices in vitro.
24635948 The association of PROCR rs867186 with severe malaria is examined in Thai population and showed significant association with protection from severe malaria.
24627030 The degree of arteriovenous fistula stenosis was not correlated with serum EPCR
24495480 results demonstrate that EPCR is overexpressed and mediates the aggressive behavior of rheumatoid synovial fibroblasts, and is likely driven by group V secretory phospholipase A2
24436369 PROCR H1 protects against venous thromboembolism. There is an increased risk of VTE associated with the H3 haplotype.
24308805 results did not conclusively identify a direct role of sEPCR in HSP, but our findings warrant further investigations, especially in severe HSP cases characterized by gastrointestinal bleeding or renal involvement
24158116 The EPCR AA genotype was significantly more frequent in the healthy volunteers free of venous thrombosis.
24127121 Piperlonguminine might have potential as an anti-sEPCR shedding reagent against PMA-mediated EPCR shedding.
24051141 Our data suggest that mutations that impair PC-EPCR interactions may be associated with an increased risk of venous thromboembolism.
24024878 EPCR expression in breast cancer cells, despite having initial growth advantage, may have a role in limiting cancer progression at an advanced stage
23993723 The study suggests a putative role of EPCR SNPs in the development of thrombosis in multiple myeloma patients.
23881209 3 polymorphisms in the EPCR gene were genotyped in 389 critically ill Greek patients to assess genetic risk for developing severe sepsis or septic shock. H2 carriers had an excess of ss/ss vs. genotypes H1 and H3.
23877403 sEPCR acts on the innate immune response by decreasing effector cells such as natural killer and T helper cells (TH2, TH17 and TH21).
23875041 Increased EPCR-levels correlate with accelerated mortality in patients with melioidosis.
23741007 Loss of EPCR and Thrombomodulin at sites of malaria-infected erythrocytes cytoadherence is detectible in nonfatal cerebral malaria.
23739325 identification of endothelial protein C receptor (EPCR), which mediates the cytoprotective effects of activated protein C, as the endothelial receptor for Plasmodium falciparum
23724628 These observations provide evidence that EPCR may be involved in the carcinogenesis of lung cancer. EPCR may be a useful biomarker for evaluating the clinical status of lung cancer
23717683 conclude that urinary sEPCR could be a novel non-invasive biomarker of antibody mediated rejection in renal transplantation
23661674 Endothelial protease nexin-1 is a novel regulator of A disintegrin and metalloproteinase 17 maturation and endothelial protein C receptor shedding via furin inhibition.
23581230 EPCR was involved in regulating progression of human lung cancer cells. Manipulation of EPCR expression may be a potential therapeutic strategy for lung cancer.
23555015 Rab GTPases regulate endothelial cell protein C receptor-mediated endocytosis and trafficking of factor VIIa.
23539451 Tissue factor promoted tumor growth may be attenuated by EPCR expression.
23408932 Under static conditions, human monocytes bind soluble EPCR in a concentration dependent manner, as demonstrated by flow cytometry. Binding can be inhibited by specific antibodies (anti-EPCR and anti-Mac-1).
23377316 The ratio of sEPCR levels to protein C activity is high, with a significant negative correlation in patients with STEMI. The sEPCR level has no relation to the development of no-reflow.
23348224 EPCR and APC play a limited role in the host response during pulmonary tuberculosis.
23342274 EPCR is expressed not only by a wide range of human malignant hematological cells but also the detection of plasma sEPCR levels provides a powerful insight into thrombotic risk assessment in cancer patients, especially when it surpasses 200 ng/mL.
23136988 findings show that in patients with coronary artery disease, circulating sEPCR levels are related to classical cardiovascular risk factors and renal impairment but are not related to long-term incidence of cardiovascular events
22903729 FFAs inhibit TM-EPCR-Protein C system in endothelial cells through activating JNK signaling, which may be a mechanism for the prothrombotic state in metabolic syndrome.
22885990 Among 78 Nepalese blood donors, no one had an EPCR 23 bp insertion.
22885985 Our results demonstrate how a gammadelta TCR mediates recognition of broadly stressed human cells by engaging endothelial protein C receptor
22715361 Elevated levels of soluble endothelial protein C receptor, a sensitive marker of endothelial damage, indicated a low level of inflammation and coagulation activation in Maraviroc treated patients not picked up by other widely used markers.
22681753 data indicate that it is possible to overexpress EPCR at a sufficient level to provide protection against transplant-related thrombotic and inflammatory injury
22614534 in cancer patients, the levels of sEPCR are significantly higher than the normal range compared to healthy volunteers
22370814 Human FVIIa binds efficiently to both murine and human EPCR.
22251481 Studies indicate a significant association between the PROCR rs867186 variant and venous thromboembolism (VTE).
22036807 EPCR 1651C/G polymorphism and elevated soluble EPCR levels but low soluble EPCR levels increase the risk of idiopathic RSM.
21901231 genetic polymorphism is associated with early-onset myocardial infarction in the Italian population
21885613 Analysis of the binding of biotinylated, active-site blocked FXa, FVIIa & APC to human EPCR on ransfected CHO-EPCR & HUVECs revealed that little FXa was bound to EPCR on cell surfaces compared with FVIIa or APC.
21851971 These findings indicate that the H1 haplotype protects Behcet's patients from thrombosis, likely via increased levels of activated protein C.
21824644 The modest increase of sEPCR levels, together with the correlation with other endothelium activation/damage markers, suggest that it is more an innocent bystander of the endothelium activation/damage than an actor in PE.
21392254 High levels of protein C are determined by PROCR haplotype 3
21362311 EPCR gene 6936A/G polymorphism is associated with increased plasma levels of sEPCR. Subjects carrying 6936AG likely have an increased risk of thrombosis.
21273788 Male gender is another parameter with A3 haplotype associated with elevated soluble EPCR levels in blood, and both parameters may contribute to selective regulatory mechanisms of EPCR release upon inflammation.
21252088 FVIIa, upon binding to EPCR on endothelial cells, activates endogenous protease activated receptor-1 (PAR1) and induces PAR1-mediated p44/42 mitogen-activated protein kinase (MAPK) activation.
21228323 Data suggest that activated protein C protects endothelial cells by attenuating cell adhesion molecule expression during inflammation, and that APC engages a regulatory crosstalk involving EPCR, ERK1/2, and NF-kappaB that impairs TNF signaling.
21149441 EPCR interacts with the ternary TF coagulation initiation complex to enable PAR1,2 signaling.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20619102 EPCR gene was found in 91.7% of solid tumors.
20506163 Data show that occupancy of EPCR by protein C switches signaling specificity so that activation of PAR-1 by thrombin inhibits TNF-alpha-mediated synthesis of IL-6 and IL-8 and down-regulates TGF-beta-mediated expression of collagen type 4 and fibronectin.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20141580 Suggest that the PROCR 6936G allele when carried by the father may be a risk factor for iliac deep vein thrombosis during pregnancy.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19895674 Endothelial protein C receptor plays an unexpected role in supporting cell surface recruitment, PAR1 activation, and signaling by FXa.
19860767 Observational study of gene-disease association. (HuGE Navigator)
19806250 polymorphism is associated with the risk of foetal loss in Mediterranean European couples
19696402 Higher soluble EPCR levels were confirmed for Gly allele carriers (P<0.0001).
19689997 Soluble endothelial protein C receptor did not show any positive correlation between these proinflammatory cytokines (TNF-alpha, IL-1beta, IL-2, IL-6, and IL-8).
19634686 Activated protein C protects endothelial cells from inflammatory mediators through an EPCR-dependent mechanism.
19587380 FVIIa or activated protein C binding to EPCR promotes EPCR endocytosis, and EPCR-mediated endocytosis may facilitate the transcytosis of FVIIa and its clearance from the circulation
19467228 Results suggest that the shedding of endothelial protein C receptors in HUVEC is effectively regulated by IL-1beta and TNF-alpha, and downstream by MAP kinase signaling pathways and metalloproteinases.
19436051 significantly increased expression of EPCR and TM in the valvular sinus endothelium as opposed to the vein lumenal endothelium, and the opposite pattern with VWF
19296056 negative relationship between sEPCR levels and the age of individuals
19238444 HuGE review of gene-disease association and gene-environment interaction. (HuGE Navigator)
19236779 A6936G polymorphism of EPCR can be detected in Chinese Han population which may be correlated with increasing risk of thrombosis in cerebral infarction patients.
19236779 Observational study of gene-disease association. (HuGE Navigator)
19222470 Observational study of gene-disease association. (HuGE Navigator)
19129726 Protein C is activated on the surface of endothelial cells by the thrombin-thrombomodulin complex with the stimulation of the endothelial protein C receptor.
19004141 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18977990 Observational study of gene-disease association. (HuGE Navigator)
18757851 carriers of the A3 haplotype have a reduced risk of myocardial infarction, only in part due to increased soluble endothelial protein C levels
18757851 Observational study of gene-disease association. (HuGE Navigator)
18680534 no association between PROCR Ser219Gly and risk of CHD, stroke, or mortality; the minor allele SNP, rs2069948, was associated with lymphoid PROCR mRNA expression and increased risk of incident stroke and all-cause mortality, and decreased healthy survival
18680534 Observational study of gene-disease association. (HuGE Navigator)
18612544 Protease activated receptor 1 (PAR-1) activation by thrombin is protective in human pulmonary artery endothelial cells if endothelial protein C receptor is occupied by its natural ligand, protein C.
18604550 Possible role of soluble EPCR in the pathogenesis of Behcet's disease. Studies of mutations and polymorphisms in EPCR gene in patients with Behcet's disease might bring to light pathogenic mechanism of ocular and systemic vascular complications.
18555797 Expression of protein-C receptor in vascular endothelium is activated by aldesterone.
18539144 The EPCR A1 haplotype reduced the risk for recurrent miscarriage in carriers of FV Leiden.
18539144 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18480081 Observational study of gene-disease association. (HuGE Navigator)
18443268 tEPCR behaves as sEPCR generated by shedding of the cellular endothelial cell protein C receptor
18403391 in 20210A carriers the venous thromboembolism risk is influenced both by the actual prothrombin levels and by the EPCR A3 haplotype, via its effect on sEPCR levels
18403391 Observational study of gene-disease association. (HuGE Navigator)
18278202 Failed to validate association of EPCR gene polymorphisms with venous thromboembolism amoung Californians of European ancestry.
18160602 Observational study of gene-disease association. (HuGE Navigator)
18073349 the sEPCRisoform could contribute to the regulatory effect of sEPCR in plasma.
17849044 Highlights the different mutations/polymorphisms reported in the EPCR gene and their association with the risk of thrombosis.
17823308 when EPCR is bound by protein C, the PAR-1 cleavage-dependent protective signaling responses in endothelial cells can be mediated by either thrombin or APC.
17570903 relationship between plasma sEPCR levels and development of arteriovenous fistula thromboses
17454790 Homozygous 23-bp insertion of endothelial protein c receptor gene is associated with fatal sepsis
17439632 the presence of anti-EPCR autoantibodies is a moderate risk factor for deep vein thrombosis in the general population
17327234 EPCR serves as a cellular binding site for FVII/FVIIa
17170365 EPCR expression is detected in smooth muscle cells in the fibrous cap of human carotid artery plaques.
17155946 the EPCR sequence requirement for shedding is amino acids from residue 193 to residue 200. ADAM17 is responsible for EPCR shedding.
17099210 Observational study of gene-disease association. (HuGE Navigator)
17099210 mutations in the EPCR are not a major cause of recurrent miscarriage although they may exert a modifier effect in combination with other variants
17099142 Release of EPCR into the conditioned medium was inhibited by the metalloproteinase inhibitors TAPI and GM6001, indicating that the shedding of EPCR from the alveolar epithelium is mediated by a metalloproteinase.
17054378 Gamma-carboxyglutamic acid--> Lysine mutation causes a significant reduction in the binding force between this protein and protein C.
17049585 possible role for high levels of thrombomodulin as a marker of HCC development in patients with cirrhosis, whereas high levels of EPCR are a possible marker of worse HCC prognosis, being a sign of endothelial damage of large vessels
17027065 Observational study of gene-disease association. (HuGE Navigator)
17027065 study confirms that there is a strong association between A3 haplotype and elevated sEPCR levels; we suggest that elevated sEPCR levels might increase the risk of stroke at pediatric age
16444434 Observational study of gene-disease association. (HuGE Navigator)
16409473 the A3 haplotype does promote cellular shedding in either 293 or endothelial cells and therefore is likely directly contributory to the higher soluble EPCR levels seen in patients carrying this haplotype
16354200 In cultured keratinocytes, EPCR expression was upregulated by the addition of activated protein C and inhibited by tumor necrosis factor-alpha
16354176 In vascular endotheliumt, binds activated protein C, generating an anti-inflammatory response.
16153429 CRP significantly decreases the expression of thrombomodulin and EPCR in human endothelial cells, thereby promoting thrombogenic conditions.
16113830 Observational study of gene-disease association. (HuGE Navigator)
16113830 EPCR 4600A/G and 4678G/C polymorphisms may be involved in venous thromboembolism in carriers of factor V Leiden
15978102 protein C receptor autoantibodies may have a role in acute myocardial infarction in young women
15954900 the vascular dysfunction characteristic of systemic lupus erythematosus may be related to a dramatically altered distribution of EPCR, both soluble and membrane-bound forms
15921688 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
15921688 EPCR-transfected cells suggested increased basal release of sEPCR from cells expressing the 219Gly EPCR phenotype.
15710622 endothelial protein C receptor ligation and sphingosine 1-phosphate receptor transactivation results in endothelial cell cytoskeletal rearrangement and barrier protection through activated protein C
15634335 protein C binding to sEPCR and phospholipids is broadly dependent on correct Gla domain folding, but can be selectively influenced by judicious mutation
15304035 Observational study of gene-disease association. (HuGE Navigator)
15304035 this study does not show a strong association between EPCR haplotypes and thrombosis risk, but low sEPCR levels may reduce the risk of deep venous thrombosis
15178554 Review. TM, APC, & EPCR impact coagulation, inflammation, fibrinolysis, & cell proliferation. We review the functions of this complex multimolecular system & how its components maintain homeostasis under hypercoagulable &/or proinflammatory conditions.
15150078 Anti-EPCR autoantibodies can be detected in antiphospholid syndrome patients and are independent risk factors for fetal death.
15116250 Observational study of gene-disease association. (HuGE Navigator)
15116250 individuals carrying the 4600AG EPCR genotype have high sEPCR levels but do not have an increased risk of thrombosis, whereas individuals carrying the 4678CC genotype have higher APC levels and lower risk of venous thromboembolism
15080580 Endothelial protein C receptor may play an important inflammation-related role in plaque development.
14576048 Observational study of gene-disease association. (HuGE Navigator)
12897745 Endothelial protein C receptor expressed by eosinophils activated with protein C or activated protein C arrests directed migration
12586611 data suggest that activated protein C regulates calcium concentration in human brain endothelium and in human umbilical vein endothelial cells by binding to endothelial protein C receptor and signaling via protease activated receptor-1
12560236 Functional analysis of a hypersensitive site in the 5' flanking region of the hEPCR gene in endothelial cells identified multiple regions, containing high and low homology consensus Sp1 binding sequences, that were protected from methylation.
12529763 Observational study of gene-disease association. (HuGE Navigator)
12514663 Observational study of gene-disease association. (HuGE Navigator)
12439143 Observational study of gene-disease association. (HuGE Navigator)
12413583 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12152662 Observational study of gene-disease association. (HuGE Navigator)
12152660 Observational study of gene-disease association. (HuGE Navigator)
11776299 Observational study of gene-disease association. (HuGE Navigator)
11776299 Our findings showed that the EPCR 23bp insertion is very rare in both patients with VTE and the general population and failed to support an association between the EPCR 23bp insertion and an increased risk of VTE.
11686350 A 23bp insertion in the endothelial protein C receptor (EPCR) gene impairs EPCR function. Since protein C activation depends on the concentration of EPCR, patients with the EPCR insertion could have a diminished protein C activation capacity.
11552992 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLTTLLPILLLSGWAFCSQDASDGLQRLHMLQISYFRDPYHVWYQGNASLGGHLTHVLEGPDTNTTIIQL      1 - 70
QPLQEPESWARTQSGLQSYLLQFHGLVRLVHQERTLAFPLTIRCFLGCELPPEGSRAHVFFEVAVNGSSF     71 - 140
VSFRPERALWQADTQVTSGVVTFTLQQLNAYNRTRYELREFLEDTCVQYVQKHISAENTKGSQTSRSYTS    141 - 210
LVLGVLVGSFIIAGVAVGIFLCTGGRRC                                              211 - 238
//

Text Mined References (171)

PMID Year Title
26620701 2015 Haplotypes of the endothelial protein C receptor (EPCR) gene are not associated with severe malaria in Tanzania.
26119044 2015 Diverse functional outcomes of Plasmodium falciparum ligation of EPCR: potential implications for malarial pathogenesis.
26118955 2015 Plasmodium falciparum adhesion domains linked to severe malaria differ in blockade of endothelial protein C receptor.
26015475 2015 IgG antibodies to endothelial protein C receptor-binding cysteine-rich interdomain region domains of Plasmodium falciparum erythrocyte membrane protein 1 are acquired early in life in individuals exposed to malaria.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25895599 2015 Endothelial cell protein C receptor promotes MGC803 gastric cancer cells proliferation and migration by activating ERK1/2.
25667200 2015 Activation of Protein C in Human Trophoblasts in Culture and Downregulation of Trophoblast Endothelial Protein C Receptor by TNF-?.
25588409 2015 Serum sEPCR levels are elevated in patients with Alzheimer's disease.
25541704 2014 Endothelial protein C receptor gene variants not associated with severe malaria in ghanaian children.
25425698 2015 High plasma levels of soluble endothelial protein C receptor are associated with increased mortality among children with cerebral malaria in Benin.
25407022 2014 Increased coagulation activity and genetic polymorphisms in the F5, F10 and EPCR genes are associated with breast cancer: a case-control study.
25376901 2014 Genetic markers associated with plasma protein C level in African Americans: the atherosclerosis risk in communities (ARIC) study.
25246042 2014 Differential expression of leukocyte receptors in disseminated intravascular coagulation: prognostic value of low protein C receptor expression.
24862151 2014 Role of the protein C receptor in cancer progression.
24635948 2014 Association of the endothelial protein C receptor (PROCR) rs867186-G allele with protection from severe malaria.
24627030 2015 Relationship of late arteriovenous fistula stenosis with soluble E-selectin and soluble EPCR in chronic hemodialysis patients with arteriovenous fistula.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24495480 2014 Endothelial protein C receptor-associated invasiveness of rheumatoid synovial fibroblasts is likely driven by group V secretory phospholipase A2.
24436369 2014 Functional analysis of two haplotypes of the human endothelial protein C receptor gene.
24308805 2015 An analysis of the levels of the soluble form of the endothelial protein C receptor in children with Henoch-Schönlein Purpura.
24158116 2013 Three polymorphisms in promoter of protein C gene with endothelial protein c receptor gene and risk of venous thrombosis.
24127121 2014 Piperlonguminine downregulates endothelial protein C receptor shedding in vitro and in vivo.
24051141 2013 Targeted gene sequencing identifies variants in the protein C and endothelial protein C receptor genes in patients with unprovoked venous thromboembolism.
24024878 2013 Influence of endothelial cell protein C receptor on breast cancer development.
23993723 2013 Decreased incidence of EPCR 4678G/C SNP in multiple myeloma patients with thrombosis.
23881209 2013 Endothelial protein C receptor polymorphisms and risk of severe sepsis in critically ill patients.
23877403 2013 Plasma endothelial protein C receptor influences innate immune response in ovarian cancer by decreasing the population of natural killer and TH17 helper cells.
23875041 2013 Overexpression of the endothelial protein C receptor is detrimental during pneumonia-derived gram-negative sepsis (Melioidosis).
23741007 2013 Loss of endothelial protein C receptors links coagulation and inflammation to parasite sequestration in cerebral malaria in African children.
23739325 2013 Severe malaria is associated with parasite binding to endothelial protein C receptor.
23724628 2013 Endothelial cell protein C receptor (EPCR) is expressed by lung carcinoma and correlated with clinical parameters.
23717683 2013 Renal and urinary levels of endothelial protein C receptor correlate with acute renal allograft rejection.
23661674 2013 Endothelial protease nexin-1 is a novel regulator of A disintegrin and metalloproteinase 17 maturation and endothelial protein C receptor shedding via furin inhibition.
23581230 2012 Inhibition of cellular growth and migration by suppression of endothelial protein C receptor (EPCR) in lung carcinoma cells.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23555015 2013 Rab GTPases regulate endothelial cell protein C receptor-mediated endocytosis and trafficking of factor VIIa.
23539451 2013 Endothelial cell protein C receptor opposes mesothelioma growth driven by tissue factor.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23408932 2013 Mac-1 directly binds to the endothelial protein C-receptor: a link between the protein C anticoagulant pathway and inflammation?
23377316 2013 Soluble endothelial protein C receptor levels and protein C activity in patients with acute ST-segment elevation myocardial infarction.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23348224 2013 The endothelial protein C receptor and activated protein C play a limited role in host defense during experimental tuberculosis.
23342274 2012 Soluble endothelial protein C receptor (sEPCR) is likely a biomarker of cancer-associated hypercoagulability in human hematologic malignancies.
23136988 2012 Association of soluble endothelial protein C receptor plasma levels and PROCR rs867186 with cardiovascular risk factors and cardiovascular events in coronary artery disease patients: the Athero Gene study.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22903729 2012 Free fatty acids inhibit TM-EPCR expression through JNK pathway: an implication for the development of the prothrombotic state in metabolic syndrome.
22885990 2013 Prevalence of factor V G1691A, factor II G20210A, methylenetetrahydrofolate reductase C677T and endothelial protein C receptor 23 bp insertion polymorphisms in indigenous population of Nepal.
22885985 2012 Cytomegalovirus and tumor stress surveillance by binding of a human ?? T cell antigen receptor to endothelial protein C receptor.
22715361 2012 Levels of soluble endothelial protein C receptor are associated with CD4+ changes in Maraviroc-treated HIV-infected patients.
22703881 2012 Genetic associations for activated partial thromboplastin time and prothrombin time, their gene expression profiles, and risk of coronary artery disease.
22681753 2012 Protective effects of transgenic human endothelial protein C receptor expression in murine models of transplantation.
22614534 2012 Endothelial protein C receptor expressed by ovarian cancer cells as a possible biomarker of cancer onset.
22443383 2012 Genome wide association study for plasma levels of natural anticoagulant inhibitors and protein C anticoagulant pathway: the MARTHA project.
22370814 2012 Factor VIIa binding to endothelial cell protein C receptor: differences between mouse and human systems.
22251481 2012 The endothelial protein C receptor (PROCR) Ser219Gly variant and risk of common thrombotic disorders: a HuGE review and meta-analysis of evidence from observational studies.
22216198 2011 A genome-wide association study of the Protein C anticoagulant pathway.
22036807 2012 Endothelial protein C receptor 1651C/G polymorphism and soluble endothelial protein C receptor levels in women with idiopathic recurrent miscarriage.
21901231 2011 Common variants in the haemostatic gene pathway contribute to risk of early-onset myocardial infarction in the Italian population.
21885613 2011 Factor X binding to endothelial cell protein C receptor: comparison with factor VIIa and activated protein C.
21851971 2012 Haplotypes of the endothelial protein C receptor gene and Behçet's disease.
21824644 2012 Elevated soluble endothelial cell protein C receptor (sEPCR) levels in women with preeclampsia: a marker of endothelial activation/damage?
21502573 2011 Genetic predictors of fibrin D-dimer levels in healthy adults.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21392254 2011 High levels of protein C are determined by PROCR haplotype 3.
21362311 2011 Relationship between endothelial cell protein C receptor gene 6936A/G polymorphisms and deep venous thrombosis.
21273788 2011 Circulating endothelial cell protein C receptor: endothelial regulation and cumulative impact of gender and A3 haplotype.
21269460 2011 Initial characterization of the human central proteome.
21252088 2011 Factor VIIa bound to endothelial cell protein C receptor activates protease activated receptor-1 and mediates cell signaling and barrier protection.
21228323 2011 Protective cross talk between activated protein C and TNF signaling in vascular endothelial cells: implication of EPCR, noncanonical NF-?B, and ERK1/2 MAP kinases.
21149441 2011 The endothelial protein C receptor supports tissue factor ternary coagulation initiation complex signaling through protease-activated receptors.
20826780 2010 Factor X/Xa elicits protective signaling responses in endothelial cells directly via PAR-2 and indirectly via endothelial protein C receptor-dependent recruitment of PAR-1.
20802025 2010 Genome-wide association study identifies novel loci for plasma levels of protein C: the ARIC study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20619102 2010 [Expression of endothelial protein C receptor in tumor cell lines and It's significance].
20506163 2010 Thrombin down-regulates the TGF-beta-mediated synthesis of collagen and fibronectin by human proximal tubule epithelial cells through the EPCR-dependent activation of PAR-1.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20231535 2010 Novel associations of multiple genetic loci with plasma levels of factor VII, factor VIII, and von Willebrand factor: The CHARGE (Cohorts for Heart and Aging Research in Genome Epidemiology) Consortium.
20141580 2010 Paternal endothelial protein C receptor 219Gly variant as a mild and limited risk factor for deep vein thrombosis during pregnancy.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19895674 2010 Coagulation factor Xa cleaves protease-activated receptor-1 and mediates signaling dependent on binding to the endothelial protein C receptor.
19860767 2011 Genetic cardiovascular risk factors and age-related macular degeneration.
19806250 2009 The A6936G polymorphism of the endothelial protein C receptor gene is associated with the risk of unexplained foetal loss in Mediterranean European couples.
19696402 2009 FVII, FVIIa, and downstream markers of extrinsic pathway activation differ by EPCR Ser219Gly variant in healthy men.
19689997 2011 Relation of soluble endothelial protein C receptor and cytokines after allogeneic hematopoietic stem cell transplantation.
19634686 2009 Activated protein C ameliorates TNF-alpha-induced inflammatory response of endothelium via the endothelial protein C receptor.
19587380 2009 Endothelial cell protein C receptor cellular localization and trafficking: potential functional implications.
19581412 2009 Quantitative proteomics identifies a Dab2/integrin module regulating cell migration.
19467228 2009 Regulation of endothelial protein C receptor shedding by cytokines is mediated through differential activation of MAP kinase signaling pathways.
19436051 2009 Valves of the deep venous system: an overlooked risk factor.
19296056 2010 Soluble endothelial protein C receptor levels in healthy population.
19238444 2009 The genomic basis of cerebral palsy: a HuGE systematic literature review.
19236779 2009 [Correlation between gene polymorphism of endothelial protein C receptor and cerebral infarction in Chinese Han population of Hubei province].
19222470 2009 Lack of association of soluble endothelial protein C receptor and PROCR 6936A/G polymorphism with the risk of venous thromboembolism in a prospective study.
19129726 2009 Heritability of plasma concentrations of activated protein C in a Spanish population.
19004141 Thrombophilia and unexplained pregnancy loss in Indian patients.
18977990 2008 Candidate genes and cerebral palsy: a population-based study.
18757851 2008 Endothelial protein C receptor polymorphisms and risk of myocardial infarction.
18680534 2008 PROC, PROCR and PROS1 polymorphisms, plasma anticoagulant phenotypes, and risk of cardiovascular disease and mortality in older adults: the Cardiovascular Health Study.
18612544 2008 Protease activated receptor 1 (PAR-1) activation by thrombin is protective in human pulmonary artery endothelial cells if endothelial protein C receptor is occupied by its natural ligand.
18604550 2008 Soluble endothelial protein C receptor levels in Behçet patients with and without ocular involvement.
18555797 2008 Aldosterone modifies hemostasis via upregulation of the protein-C receptor in human vascular endothelium.
18539144 2008 Association of endothelial protein C receptor haplotypes, factor V Leiden and recurrent first trimester pregnancy loss.
18480081 2009 Congenital thrombotic risk factors in beta-thalassemia.
18443268 2008 The functional properties of a truncated form of endothelial cell protein C receptor generated by alternative splicing.
18403391 2008 Haplotypes of the EPCR gene, prothrombin levels, and the risk of venous thrombosis in carriers of the prothrombin G20210A mutation.
18278202 2008 Failure to validate association of gene polymorphisms in EPCR, PAR-1, FSAP and protein S Tokushima with venous thromboembolism among Californians of European ancestry.
18160602 2008 The importance of thrombotic risk factors in the development of idiopathic sudden hearing loss.
18073349 2008 Alternative mRNA is favored by the A3 haplotype of the EPCR gene PROCR and generates a novel soluble form of EPCR in plasma.
17849044 2007 Polymorphisms in the endothelial protein C receptor gene and thrombophilia.
17823308 2007 The ligand occupancy of endothelial protein C receptor switches the protease-activated receptor 1-dependent signaling specificity of thrombin from a permeability-enhancing to a barrier-protective response in endothelial cells.
17570903 2007 Soluble endothelial protein C receptor: influence on arteriovenous fistula thrombosis development in hemodialysis patients.
17454790 Homozygous 23-bp insertion of endothelial protein c receptor gene in a child with fatal sepsis.
17439632 2007 Autoantibodies against endothelial protein C receptor and the risk of a first deep vein thrombosis.
17327234 2007 Endothelial cell protein C receptor acts as a cellular receptor for factor VIIa on endothelium.
17170365 2007 Human vascular smooth muscle cells express functionally active endothelial cell protein C receptor.
17155946 2007 Regulated endothelial protein C receptor shedding is mediated by tumor necrosis factor-alpha converting enzyme/ADAM17.
17099210 2007 Variations in the thrombomodulin and endothelial protein C receptor genes in couples with recurrent miscarriage.
17099142 2007 Novel role of the human alveolar epithelium in regulating intra-alveolar coagulation.
17054378 2006 Molecular dynamics calculations of wild type vs. mutant protein C: relationship between binding affinity to endothelial cell protein C receptor and hereditary disease.
17049585 2007 Endothelial protein C receptor plasma levels increase in chronic liver disease, while thrombomodulin plasma levels increase only in hepatocellular carcinoma.
17027065 2007 EPCR gene A3 haplotype and elevated soluble endothelial protein C receptor (sEPCR) levels in Turkish pediatric stroke patients.
16444434 2006 Effect of various genetic polymorphisms on the incidence and outcome of severe sepsis.
16409473 2006 The Ser219-->Gly dimorphism of the endothelial protein C receptor contributes to the higher soluble protein levels observed in individuals with the A3 haplotype.
16354200 2005 Endothelial protein C receptor and protease-activated receptor-1 mediate induction of a wound-healing phenotype in human keratinocytes by activated protein C.
16354176 2005 Further evidence of multifunctionality in the keratinocyte: the endothelial protein C receptor.
16153429 2005 C-reactive protein decreases expression of thrombomodulin and endothelial protein C receptor in human endothelial cells.
16113830 2005 Influence of the 4600A/G and 4678G/C polymorphisms in the endothelial protein C receptor (EPCR) gene on the risk of venous thromboembolism in carriers of factor V Leiden.
15978102 2005 Autoantibodies against the endothelial receptor of protein C are associated with acute myocardial infarction in young women.
15954900 2005 Shedding of endothelial protein C receptor contributes to vasculopathy and renal injury in lupus: in vivo and in vitro evidence.
15921688 2005 EPCR Ser219Gly: elevated sEPCR, prothrombin F1+2, risk for coronary heart disease, and increased sEPCR shedding in vitro.
15710622 2005 Activated protein C mediates novel lung endothelial barrier enhancement: role of sphingosine 1-phosphate receptor transactivation.
15634335 2005 Selective modulation of protein C affinity for EPCR and phospholipids by Gla domain mutation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15304035 2004 Haplotypes of the EPCR gene, plasma sEPCR levels and the risk of deep venous thrombosis.
15178554 2004 Thrombomodulin-protein C-EPCR system: integrated to regulate coagulation and inflammation.
15150078 2004 Autoantibodies against EPCR are found in antiphospholipid syndrome and are a risk factor for fetal death.
15116250 2004 Contribution of polymorphisms in the endothelial protein C receptor gene to soluble endothelial protein C receptor and circulating activated protein C levels, and thrombotic risk.
15080580 2004 Expression of endothelial protein C receptor and thrombomodulin in human coronary atherosclerotic plaques.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14576048 2004 A haplotype of the EPCR gene is associated with increased plasma levels of sEPCR and is a candidate risk factor for thrombosis.
12911608 2003 Identification and characterization of a natural R96C EPCR variant.
12897745 2003 Endothelial protein C receptor-dependent inhibition of human eosinophil chemotaxis by protein C.
12871285 2003 Specificity of coagulation factor signaling.
12831462 2003 Coagulation and inflammation.
12683950 2003 Inhibition of staurosporine-induced apoptosis of endothelial cells by activated protein C requires protease-activated receptor-1 and endothelial cell protein C receptor.
12586611 2003 Activated protein C alters cytosolic calcium flux in human brain endothelium via binding to endothelial protein C receptor and activation of protease activated receptor-1.
12563316 2003 Activated protein C blocks p53-mediated apoptosis in ischemic human brain endothelium and is neuroprotective.
12560236 2003 Regulation of the human endothelial cell protein C receptor gene promoter by multiple Sp1 binding sites.
12529763 2002 Endothelial cell protein C receptor (EPCR) gene exon III, 23 bp insertion mutation in the Turkish pediatric thrombotic patients.
12514663 2003 Potential thrombophilic mutations/polymorphisms in patients with no flow-limiting stenosis after myocardial infarction.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12439143 2002 Genetic risk factors in young adults with 'cryptogenic' ischemic cerebrovascular disease.
12413583 2002 CBS 844ins68, MTHFR TT677 and EPCR 4031ins23 genotypes in patients with deep-vein thrombosis.
12152662 2002 The G7763C endothelial protein C receptor (EPCR) gene mutation: prevalence and association with DVT in the Irish population.
12152660 2002 The endothelial protein C receptor (EPCR) 23 bp insert mutation and the risk of venous thrombosis.
12052963 2002 Activation of endothelial cell protease activated receptor 1 by the protein C pathway.
12034704 2002 The crystal structure of the endothelial protein C receptor and a bound phospholipid.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11703343 2001 Characterization of protein C receptor expression in monocytes.
11686350 2001 A 23bp insertion in the endothelial protein C receptor (EPCR) gene impairs EPCR function.
11552992 2001 Mutations in the thrombomodulin and endothelial protein C receptor genes in women with late fetal loss.
11099506 2001 Identification of the protein C/activated protein C binding sites on the endothelial cell protein C receptor. Implications for a novel mode of ligand recognition by a major histocompatibility complex class 1-type receptor.
10681599 2000 Metalloproteolytic release of endothelial cell protein C receptor.
10681521 2000 Mechanisms by which soluble endothelial cell protein C receptor modulates protein C and activated protein C function.
10570964 1999 Organization and chromosomal localization of the human endothelial protein C receptor gene.
10518938 1999 One single mRNA encodes the centrosomal protein CCD41 and the endothelial cell protein C receptor (EPCR).
10397730 1999 Structural and functional implications of the intron/exon organization of the human endothelial cell protein C/activated protein C receptor (EPCR) gene: comparison with the structure of CD1/major histocompatibility complex alpha1 and alpha2 domains.
10364477 1999 The endothelial cell protein C receptor (EPCR) functions as a primary receptor for protein C activation on endothelial cells in arteries, veins, and capillaries.
9396465 1997 Human protein C receptor is present primarily on endothelium of large blood vessels: implications for the control of the protein C pathway.
7929370 1994 Identification, cloning, and regulation of a novel endothelial cell protein C/activated protein C receptor.
1051893 1976 Nursing in transition.