Property Summary

NCBI Gene PubMed Count 1
PubMed Score 3.88
PubTator Score 3.00

Knowledge Summary


No data available


  Disease (2)

Disease Target Count P-value
psoriasis 6685 8.4e-80
Disease Target Count Z-score Confidence
Stuttering 18 4.186 2.1
Keratoconus 49 3.243 1.6


  Differential Expression (1)

Disease log2 FC p
psoriasis 1.800 8.4e-80

Gene RIF (1)

19240791 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

LPVSGTPNPAPPLLLCAPPSSSGPTQPGKGSLFPL                                       981 - 1015

Text Mined References (3)

PMID Year Title
19240791 2009 Integrated genomic analysis implicates haploinsufficiency of multiple chromosome 5q31.2 genes in de novo myelodysplastic syndromes pathogenesis.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.