Property Summary

NCBI Gene PubMed Count 37
PubMed Score 338.28
PubTator Score 115.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group A ependymoma 1.700 2.5e-03
atypical teratoid/rhabdoid tumor 3.800 8.4e-08

Gene RIF (25)

PMID Text
26950422 results demonstrate that blocking doppel can control VEGF signaling in TECs and selectively inhibit tumor angiogenesis.
22453181 The association between the APOE, CYP46, PRNP and PRND genes and the profile of neuropsychiatric symptoms in Polish subjects with Alzheimer's disease and mild cognitive impairment, was evaluated.
20981146 in astrocytomas, Dpl undergoes different molecular processes that might constitute additional helpful tools to characterize the glial tumor progression
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19728151 Cytotoxicity induced by the expression of Dpl and truncated PrP in neural derived cells are closely related with the apoptosis process.
19363267 From the logistic regression ananlsis of this stidy showed that the highest risk for was found for Alzheimer's disease individuals who co-inherited APOE epsilon4 allele, PRNP codon 129 homozygosity, PRND codon 174 Thr allele, and CYP46 rs754203 g allele.
19363267 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19129949 results suggested that the function of Dpl is antagonistic to PrP rather than synergistic
18936526 Results might suggest a potential and functional role for Dpl in tumor cells migratory and morphological behaviours and address to future gene-targeted therapeutic interventions.
17894227 Study provides the foundation for further study of Dpl biological functions in vitro and in vivo.
17390034 Extensive differences in PRND gene expression were also found within each grade of malignancy, suggesting that PRND mRNA quantitation might be useful to distinguish astrocytoma subtypes.
17201176 Dpl interacts with RACK1 by means of its structured globular carboxyl-terminal region
17047093 Observational study of gene-disease association. (HuGE Navigator)
16889908 Observational study of gene-disease association. (HuGE Navigator)
16421231 Doppel is expressed early during ontogenesis, and is found in both germ cells and Sertoli cells. Doppel may play a physiological role in acrosome biogenesis.
15986038 Observational study of gene-disease association. (HuGE Navigator)
15933804 Observational study of gene-disease association. (HuGE Navigator)
15246873 Doppel interacts with the full-length laminin receptor precursor protein
15203115 results demonstrate that Doppel and PrPc co-patch extensively at the plasma membrane
15158907 human Doppel fails to interact with itself; Dpl and PrP are not related or are only marginally related with respect to their ligand binding behaviour
14970845 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
14745079 Observational study of gene-disease association. (HuGE Navigator)
12586339 Doppel expression is not modified in the brains of patients with Creutzfeldt-Jakob disease.
12200435 expression pattern and biochemical characteristics in human tissues and in Chinese hamster ovary cells transfected with wild-type or variant human Dpl gene constructs
11702213 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRKHLSWWWLATVCMLLFSHLSAVQTRGIKHRIKWNRKALPSTAQITEAQVAENRPGAFIKQGRKLDIDF      1 - 70
GAEGNRYYEANYWQFPDGIHYNGCSEANVTKEAFVTGCINATQAANQGEFQKPDNKLHQQVLWRLVQELC     71 - 140
SLKHCEFWLERGAGLRVTMHQPVLLCLLALIWLTVK                                      141 - 176
//

Text Mined References (37)

PMID Year Title
26950422 2016 Targeting prion-like protein doppel selectively suppresses tumor angiogenesis.
22453181 PRND 3'UTR polymorphism may be associated with behavioral disturbances in Alzheimer disease.
20981146 2010 Biochemical signatures of doppel protein in human astrocytomas to support prediction in tumor malignancy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19728151 2010 Transient expressions of doppel and its structural analog prionDelta32-121 in SH-SY5Y cells caused cytotoxicity possibly by triggering similar apoptosis pathway.
19363267 2009 Earlier onset of Alzheimer's disease: risk polymorphisms within PRNP, PRND, CYP46, and APOE genes.
19129949 2009 Doppel-induced cytotoxicity in human neuronal SH-SY5Y cells is antagonized by the prion protein.
18936526 2008 The doppel (Dpl) protein influences in vitro migration capability in astrocytoma-derived cells.
17894227 2007 [Expression of recombinant human doppel protein and analysis of its cytotoxic activities].
17390034 2007 Diagnostic value of PRND gene expression profiles in astrocytomas: relationship to tumor grades of malignancy.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17201176 The prion-like protein Doppel (Dpl) interacts with the human receptor for activated C-kinase 1 (RACK1) protein.
17047093 2006 Significant association of a M129V independent polymorphism in the 5' UTR of the PRNP gene with sporadic Creutzfeldt-Jakob disease in a large German case-control study.
16889908 2006 Polymorphic microsatellite sites in the PRNP region point to excess of homozygotes in Creutzfeldt-Jakob disease patients.
16421231 2006 Spatio-developmental distribution of the prion-like protein doppel in Mammalian testis: a comparative analysis focusing on its presence in the acrosome of spermatids.
15986038 2005 Polymorphism at 3' UTR +28 of the prion-like protein gene is associated with sporadic Creutzfeldt-Jakob disease.
15933804 2005 Polymorphisms at codons 56 and 174 of the prion-like protein gene (PRND) are not associated with sporadic Creutzfeldt-Jakob disease.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15246873 2004 Interaction of Doppel with the full-length laminin receptor precursor protein.
15203115 2004 Human Doppel and prion protein share common membrane microdomains and internalization pathways.
15158907 2004 The prion-like protein Doppel fails to interact with itself, the prion protein and the 37 kDa/67 kDa laminin receptor in the yeast two-hybrid system.
14970845 2004 Polymorphisms in the prion protein gene and in the doppel gene increase susceptibility for Creutzfeldt-Jakob disease.
14745079 2004 Polymorphisms within the prion (PrP) and prion-like protein (Doppel) genes in AD.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12595265 2003 NMR structure of the human doppel protein.
12586339 2003 Prion-like protein Doppel expression is not modified in scrapie-infected cells and in the brains of patients with Creutzfeldt-Jakob disease.
12514748 2002 Genomic characterization of the human prion protein (PrP) gene locus.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12399017 2002 Polymorphism at codon 174 of the prion-like protein gene is not associated with sporadic Alzheimer's disease.
12200435 2002 The human "prion-like" protein Doppel is expressed in both Sertoli cells and spermatozoa.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11734625 2001 Doppel-induced cerebellar degeneration in transgenic mice.
11702213 2001 Polymorphisms within the prion-like protein gene (Prnd) and their implications in human prion diseases, Alzheimer's disease and other neurological disorders.
11063595 2000 Expression and structural characterization of the recombinant human doppel protein.
10825657 2000 First report of polymorphisms in the prion-like protein gene (PRND): implications for human prion diseases.
10577243 1999 Perspectives: neurobiology. PrP's double causes trouble.
10525406 1999 Ataxia in prion protein (PrP)-deficient mice is associated with upregulation of the novel PrP-like protein doppel.