Property Summary

NCBI Gene PubMed Count 34
PubMed Score 18.91
PubTator Score 27.94

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.300 8.5e-06
posterior fossa group B ependymoma 1.300 9.9e-06
glioblastoma 1.400 6.6e-07
medulloblastoma, large-cell 1.200 3.2e-04
non-small cell lung cancer 1.207 9.6e-16
lung cancer 1.900 1.9e-05
adult high grade glioma 1.400 1.8e-03
atypical teratoid/rhabdoid tumor 1.100 5.1e-04
nasopharyngeal carcinoma 1.100 5.4e-04
lung carcinoma 1.400 1.1e-21
ovarian cancer 1.400 4.0e-03
pituitary cancer 1.200 4.5e-04

Protein-protein Interaction (1)

Gene RIF (14)

PMID Text
25187371 PRMT3 translocation by palmitic acid is coupled to the binding of LXRalpha, which is responsible for the onset of fatty liver.
24320160 This work profilies substrates of protein arginine N-methyltransferase 3 with S-adenosyl-L-methionine analogues.
23912080 results show that protein arginine methyl transferase (PRMT)-3 and -5 methylate NaV1.5 in vitro, interact with NaV1.5 in human embryonic kidney (HEK) cells, and increase NaV1.5 current density
23635657 Mutational defects in PRMT3 is not the cause of frontotemporal lobar degeneration.
22795084 The crystal structure of PRMT3 in complex with an inhibitor as well as kinetic analysis reveals an allosteric site of inhibition.
21942715 release of VHL30 from the E3 ligase complex, promotes the binding of VHL30 to a protein arginine methyltransferase, PRMT3
21059412 The Tyr87Cys and Tyr87Glu-PRMT3 variants had markedly decreased affinity to ribosomal protein S2 and, consequently, reduced enzymatic activity compared to the wild-type enzyme.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19641605 results suggest that the pathological mutation in the PABPN1 gene alters the protein conformation and induces a preferential interaction with type I PRMTs and Hsp70 chaperones
19460752 Knockdown of protein arginine methyltransferase 3 (PRMT3) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19158082 Type I Arginine Methyltransferases PRMT1 and PRMT-3 Act Distributively
15334060 DAL-1/4.1B protein significantly inhibits PRMT3 methylation of cellular substrates, which may affect mechanism through which DAL-1/4.1B affects tumor cell growth.
15175657 PRMT3 is a ribosomal protein methyltransferase that affects the cellular level of ribosomal subunits.

AA Sequence

MCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQQTPCLFCNRLFTSAEETFSHCKSE      1 - 70
HQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLYE     71 - 140
PVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALARAREDLQKMKQFAQDFVMHTDVRTCSSSTSVIA    141 - 210
DLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKK    211 - 280
VLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNK    281 - 350
YLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIK    351 - 420
HIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKP    421 - 490
FSVKAGEALKGKVTVHKSKKDPRSLTVTLTLNNSTQTYGLQ                                 491 - 531
//

Text Mined References (44)

PMID Year Title
25187371 2015 PRMT3 regulates hepatic lipogenesis through direct interaction with LXR?.
24320160 2014 Profiling substrates of protein arginine N-methyltransferase 3 with S-adenosyl-L-methionine analogues.
23912080 2013 Protein arginine methyl transferases-3 and -5 increase cell surface expression of cardiac sodium channel.
23635657 2013 Mutations in protein N-arginine methyltransferases are not the cause of FTLD-FUS.
23445220 2013 Exploiting an allosteric binding site of PRMT3 yields potent and selective inhibitors.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22795084 2012 An allosteric inhibitor of protein arginine methyltransferase 3.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21942715 2011 Proteomic dissection of the von Hippel-Lindau (VHL) interactome.
21866297 2011 Formulating a fluorogenic assay to evaluate S-adenosyl-L-methionine analogues as protein methyltransferase cofactors.
21584310 2011 Discovery of peptidylarginine deiminase-4 substrates by protein array: antagonistic citrullination and methylation of human ribosomal protein S2.
21410432 2011 Structural basis for CARM1 inhibition by indole and pyrazole inhibitors.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21059412 2011 Tyrosine 87 is vital for the activity of human protein arginine methyltransferase 3 (PRMT3).
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20541591 2010 Regulation of post-translational protein arginine methylation during HeLa cell cycle.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19641605 2009 Hsp70 chaperones and type I PRMTs are sequestered at intranuclear inclusions caused by polyalanine expansions in PABPN1.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19158082 2009 Type I Arginine Methyltransferases PRMT1 and PRMT-3 Act Distributively.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18656952 2008 Chemical and structural probing of the N-terminal residues encoded by FMR1 exon 15 and their effect on downstream arginine methylation.
18573314 2008 PRMT3 inhibits ubiquitination of ribosomal protein S2 and together forms an active enzyme complex.
18495660 2008 Promiscuous modification of the nuclear poly(A)-binding protein by multiple protein-arginine methyltransferases does not affect the aggregation behavior.
17550233 2007 A mass spectrometric study on the in vitro methylation of HMGA1a and HMGA1b proteins by PRMTs: methylation specificity, the effect of binding to AT-rich duplex DNA, and the effect of C-terminal phosphorylation.
16922515 2006 Alternative splicing modulates protein arginine methyltransferase-dependent methylation of fragile X syndrome mental retardation protein.
16705470 2006 Expression of nitric oxide related enzymes in coronary heart disease.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16420693 2006 The tumor suppressor DAL-1/4.1B and protein methylation cooperate in inducing apoptosis in MCF-7 breast cancer cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16190779 2005 Effects of ADMA upon gene expression: an insight into the pathophysiological significance of raised plasma ADMA.
15737618 2005 The tumor suppressor DAL-1/4.1B modulates protein arginine N-methyltransferase 5 activity in a substrate-specific manner.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15473865 2005 Ribosomal protein S2 is a substrate for mammalian PRMT3 (protein arginine methyltransferase 3).
15334060 2004 DAL-1/4.1B tumor suppressor interacts with protein arginine N-methyltransferase 3 (PRMT3) and inhibits its ability to methylate substrates in vitro and in vivo.
15175657 2004 PRMT3 is a ribosomal protein methyltransferase that affects the cellular levels of ribosomal subunits.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10224081 1999 Unusual sites of arginine methylation in Poly(A)-binding protein II and in vitro methylation by protein arginine methyltransferases PRMT1 and PRMT3.
9642256 1998 PRMT 3, a type I protein arginine N-methyltransferase that differs from PRMT1 in its oligomerization, subcellular localization, substrate specificity, and regulation.