Property Summary

Ligand Count 11
NCBI Gene PubMed Count 36
PubMed Score 21.23
PubTator Score 27.94

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.400 1.8e-03
atypical teratoid/rhabdoid tumor 1.100 5.1e-04
ependymoma 1.100 2.4e-06
glioblastoma 1.400 6.6e-07
lung cancer 1.400 3.7e-04
lung carcinoma 1.400 1.1e-21
malignant mesothelioma 1.300 8.5e-06
medulloblastoma, large-cell 1.200 3.2e-04
nasopharyngeal carcinoma 1.100 5.4e-04
non-small cell lung cancer 1.207 9.6e-16
ovarian cancer 1.400 4.0e-03
pituitary cancer 1.200 4.5e-04

Gene RIF (15)

AA Sequence

MCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQQTPCLFCNRLFTSAEETFSHCKSE      1 - 70
HQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLYE     71 - 140
PVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALARAREDLQKMKQFAQDFVMHTDVRTCSSSTSVIA    141 - 210
DLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKK    211 - 280
VLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNK    281 - 350
YLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIK    351 - 420
HIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKP    421 - 490
FSVKAGEALKGKVTVHKSKKDPRSLTVTLTLNNSTQTYGLQ                                 491 - 531
//

Text Mined References (46)

PMID Year Title