Property Summary

NCBI Gene PubMed Count 29
PubMed Score 18.57
PubTator Score 13.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.300 3.0e-02
psoriasis 1.900 7.8e-04
osteosarcoma -2.378 7.0e-05
ependymoma 1.100 4.4e-08
atypical teratoid / rhabdoid tumor -1.600 9.2e-05
glioblastoma -1.500 1.6e-04
medulloblastoma -1.300 7.1e-04
medulloblastoma, large-cell -2.100 1.9e-04
non-small cell lung cancer -1.022 8.0e-17
intraductal papillary-mucinous adenoma (... 1.100 6.8e-03
pediatric high grade glioma -1.100 3.6e-04
Breast cancer -1.100 1.8e-10
ovarian cancer 1.500 7.4e-05

Gene RIF (10)

PMID Text
24911119 This study demonstrates the role and significant correlation between a histone methyltransferase (PRMT2)-dependent signature, RORgamma, the cell-cycle regulation, DNA repair circuits, and breast cancer survival outcomes.
24292672 This study uncovers the molecular mechanism of PRMT2 regulating the expression of CCND1 in invasive ductal breast carcinoma.
22093364 characterization of 3 PRMT2 splice variants (PRMT2alpha, PRMT2beta, and PRMT2gamma) from breast cancer; these variants bind to ERalpha in vitro/in vivo; overall PRMT2 expression is upregulated in breast cancer and associated w/ ERalpha positivity
21851090 the SH3 domain may mediate an interaction between PRMT1 and -2 in a methylation-dependent fashion
21820040 Data suggest that post-transcriptional processing mechanism as alternative polyadenylation and splicing may play a crucial role in regulating human PRMT2 gene expression.
19405910 Here we report methylation activity from PRMT2 and compare it with PRMT1 activity using UPLC-MS/MS (ultra-performance liquid chromatography-tandem MS), gel electrophoresis, and thin-layer chromatography
19161160 Observational study of gene-disease association. (HuGE Navigator)
17587566 ligand-dependent AR conformation is essential for the recruitment and nuclear translocation of PMRT2 which acts as AR-coactivator, presumably by arginine methylation.
16648481 PRMT2 inhibits NF-kappa B function and promotes apoptosis.
12039952 PRMT2 is a novel ERalpha coactivator.

AA Sequence

MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWG      1 - 70
ERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKV     71 - 140
ILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVS    141 - 210
EWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLA    211 - 280
VKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSL    281 - 350
QEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWRRHMSVALSWAVTSRQDPT    351 - 420
SQKVGEKVFPIWR                                                             421 - 433
//

Text Mined References (31)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
24911119 2014 PRMT2 and ROR? expression are associated with breast cancer survival outcomes.
24292672 2014 Nuclear loss of protein arginine N-methyltransferase 2 in breast carcinoma is associated with tumor grade and overexpression of cyclin D1 protein.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
22093364 2012 Identification and characterization of novel spliced variants of PRMT2 in breast carcinoma.
21851090 2011 A protein arginine N-methyltransferase 1 (PRMT1) and 2 heteromeric interaction increases PRMT1 enzymatic activity.
21820040 2011 Identification and expression analysis of a novel transcript of the human PRMT2 gene resulted from alternative polyadenylation in breast cancer.
19405910 2009 Kinetic analysis of human protein arginine N-methyltransferase 2: formation of monomethyl- and asymmetric dimethyl-arginine residues on histone H4.
19161160 2009 An association study of 45 folate-related genes in spina bifida: Involvement of cubilin (CUBN) and tRNA aspartic acid methyltransferase 1 (TRDMT1).
17925405 2007 Regulation of protein arginine methyltransferase 8 (PRMT8) activity by its N-terminal domain.
17587566 2007 PRMT2, a member of the protein arginine methyltransferase family, is a coactivator of the androgen receptor.
16648481 2006 Protein methyltransferase 2 inhibits NF-kappaB function and promotes apoptosis.
16616919 2006 The arginine methyltransferase PRMT2 binds RB and regulates E2F function.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12039952 2002 Identification of protein arginine methyltransferase 2 as a coactivator for estrogen receptor alpha.
11513728 2001 Heterogeneous nuclear ribonucleoprotein E1B-AP5 is methylated in its Arg-Gly-Gly (RGG) box and interacts with human arginine methyltransferase HRMT1L1.
10830953 2000 The DNA sequence of human chromosome 21.
9545638 1998 Identification and characterization of two putative human arginine methyltransferases (HRMT1L1 and HRMT1L2).
9196002 1997 Identification and mapping of a novel human gene, HRMT1L1, homologous to the rat protein arginine N-methyltransferase 1 (PRMT1) gene.
9110174 1997 Large-scale concatenation cDNA sequencing.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.