Property Summary

NCBI Gene PubMed Count 24
PubMed Score 13.68
PubTator Score 29.83

Knowledge Summary

Patent (10,917)

TINX Plot

  Disease (2)

Disease Target Count P-value
pituitary cancer 1972 1.3e-05
Disease Target Count Z-score Confidence
pancreatic cancer 2300 0.0 2.0

Gene RIF (13)

PMID Text
26302849 The genotype "A/T" of rs12413624 in PRLHR gene was associated with a decreased risk of colorectal cancer.
26211894 Effects of systematic N-terminus deletions and benzoylations of endogenous RF-amide peptides on NPFF1R, NPFF2R, GPR10, GPR54 and GPR103.
23284171 demonstrate previously unrecognized roles for GPR10 and its upstream regulator REST in the pathogenesis of uterine fibroids
22778259 structural analysis of the human PrRP receptor (PrRPR) and the ligand-mimicking receptor variant of prolactin-releasing peptide
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
15752583 A ligand for The rat orphan receptor UHR-1.
14691196 Observational study of gene-disease association. (HuGE Navigator)
12716769 Observational study of gene-disease association. (HuGE Navigator)
12716769 There is an association of polymorphisms in this gene with blood pressure, but not obesity, in a U.K. Caucasian population.
12417311 The neuron-restrictive silencer factor confers transcriptional repression of the GPR10 gene via a putative silencer element located in the 5' promoter region.
12126742 PrRP receptor has a likely role in pheochromocytomas, based on its high expression in tumor tissue
11923475 cloning and characterization of the human PrRP receptor gene and its promoter region (PRL-releasing peptide receptor; PrRPR)

AA Sequence

MASSTTRGPRVSDLFSGLPPAVTTPANQSAEASAGNGSVAGADAPAVTPFQSLQLVHQLKGLIVLLYSVV      1 - 70
VVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCTACVPLTLAYAFEPRGWVFGGGLCHLVFFL     71 - 140
QPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLRLSAYAVLAIWALSAVLALPAAVHTYHVELKPHDVRL    141 - 210
CEEFWGSQERQRQLYAWGLLLVTYLLPLLVILLSYVRVSVKLRNRVVPGCVTQSQADWDRARRRRTFCLL    211 - 280
VVIVVVFAVCWLPLHVFNLLRDLDPHAIDPYAFGLVQLLCHWLAMSSACYNPFIYAWLHDSFREELRKLL    281 - 350
VAWPRKIAPHGQNMTVSVVI                                                      351 - 370
//

Text Mined References (24)

PMID Year Title
26302849 2015 Polymorphisms of PRLHR and HSPA12A and risk of gastric and colorectal cancer in the Chinese Han population.
26211894 2015 Effects of systematic N-terminus deletions and benzoylations of endogenous RF-amide peptides on NPFF1R, NPFF2R, GPR10, GPR54 and GPR103.
23284171 2013 Loss of the repressor REST in uterine fibroids promotes aberrant G protein-coupled receptor 10 expression and activates mammalian target of rapamycin pathway.
22778259 2012 Ligand-mimicking receptor variant discloses binding and activation mode of prolactin-releasing peptide.
22158540 2011 Genome-wide association study identifies five loci associated with susceptibility to pancreatic cancer in Chinese populations.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15885496 2005 Origin of the prolactin-releasing hormone (PRLH) receptors: evidence of coevolution between PRLH and a redundant neuropeptide Y receptor during vertebrate evolution.
15752583 2005 Characterization of a naturally-occurring polymorphism in the UHR-1 gene encoding the putative rat prolactin-releasing peptide receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14691196 2004 Association between physical activity and blood pressure is modified by variants in the G-protein coupled receptor 10.
12716769 2003 Association of polymorphisms in GPR10, the gene encoding the prolactin-releasing peptide receptor with blood pressure, but not obesity, in a U.K. Caucasian population.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417311 2002 NRSF/REST confers transcriptional repression of the GPR10 gene via a putative NRSE/RE-1 located in the 5' promoter region.
12126742 2002 Expression of prolactin-releasing peptide and its receptor in the human adrenal glands and tumor tissues of adrenocortical tumors, pheochromocytomas and neuroblastomas.
11923475 2002 Transcriptional regulation of the human PRL-releasing peptide (PrRP) receptor gene by a dopamine 2 Receptor agonist: cloning and characterization of the human PrRP receptor gene and its promoter region.
11641419 2001 The carboxyl terminus of the prolactin-releasing peptide receptor interacts with PDZ domain proteins involved in alpha-amino-3-hydroxy-5-methylisoxazole-4-propionic acid receptor clustering.
11030716 2000 Characterization of the binding of [(125)I]-human prolactin releasing peptide (PrRP) to GPR10, a novel G protein coupled receptor.
10498338 1999 Tissue distribution of prolactin-releasing peptide (PrRP) and its receptor.
10475064 1999 The quest for novel bioactive peptides utilizing orphan seven-transmembrane-domain receptors.
9607765 1998 A prolactin-releasing peptide in the brain.
8666380 1995 Cloning and chromosomal mapping of three novel genes, GPR9, GPR10, and GPR14, encoding receptors related to interleukin 8, neuropeptide Y, and somatostatin receptors.