Property Summary

NCBI Gene PubMed Count 260
PubMed Score 10147.56
PubTator Score 9150.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
malignant mesothelioma 3232 7.9e-08
pituitary cancer 1972 2.2e-07
medulloblastoma, large-cell 6241 2.6e-06
group 3 medulloblastoma 4104 1.2e-04
glioblastoma 5792 1.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (5)

Disease log2 FC p
glioblastoma 1.100 1.1e-02
group 3 medulloblastoma 4.500 1.2e-04
malignant mesothelioma -2.900 7.9e-08
medulloblastoma, large-cell 3.600 2.6e-06
pituitary cancer -7.300 2.2e-07

Protein-protein Interaction (1)

PDB (12)

Gene RIF (242)

AA Sequence

MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDK      1 - 70
RYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAI     71 - 140
LSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKI    141 - 210
DNYLKLLKCRIIHNNNC                                                         211 - 227
//

Text Mined References (262)

PMID Year Title