Property Summary

NCBI Gene PubMed Count 15
PubMed Score 27.97
PubTator Score 27.24

Knowledge Summary

Patent (4,444)

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 1.900 1.1e-02
oligodendroglioma 1.600 8.9e-14
psoriasis 1.200 2.6e-03
glioblastoma 1.200 2.3e-04
group 4 medulloblastoma 3.300 1.3e-07
atypical teratoid / rhabdoid tumor 1.400 4.3e-04
medulloblastoma, large-cell 1.800 2.7e-05
primitive neuroectodermal tumor 2.000 4.2e-04
lung cancer 1.300 2.3e-03
posterior fossa group B ependymoma 1.300 1.1e-04
lung carcinoma -1.500 9.8e-24
Breast cancer -1.200 1.1e-03
gastric carcinoma 1.800 1.2e-02
ovarian cancer 2.200 7.5e-07

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (6)

PMID Text
22020623 findings reveals a major role of PRKX, TTBK2 and RSK4 in triggering Sunitinib resistance formation; data suggest transcriptional regulation of these kinases together with other proteins might play an important role in formation of Sunitinib resistance by affecting transcription factors
21971312 MBD 4--a potential substrate for protein kinase X
21684272 The interaction of PRKX with Pin-1, Magi-1 and Bag-3 could contribute to the stimulating role of PRKX in angiogenesis.
18187620 Knockdown of protein kinase, X-linked (PRKX) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17980165 PRKX can restore normal function to PKD1-deficient kidneys and have implications for the development of preventative therapy for autosomal dominant polycystic kidney disease
12082174 PRKX kinase may regulate epithelial morphogenesis during mammalian kidney development.

AA Sequence

MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFDTLATVGTGTFGRVHLVKEKT      1 - 70
AKHFFALKVMSIPDVIRLKQEQHVHNEKSVLKEVSHPFLIRLFWTWHDERFLYMLMEYVPGGELFSYLRN     71 - 140
RGRFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILLDRDGHIKLTDFGFAKKLVDRTWTLCGTPEY    141 - 210
LAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILAGKIDFPRHLDFHVKDLIKKLLV    211 - 280
VDRTRRLGNMKNGANDVKHHRWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPENDWDTAAPVPQK    281 - 350
DLEIFKNF                                                                  351 - 358
//

Text Mined References (20)

PMID Year Title
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22020623 2012 PRKX, TTBK2 and RSK4 expression causes Sunitinib resistance in kidney carcinoma- and melanoma-cell lines.
21971312 2011 MBD 4--a potential substrate for protein kinase X.
21684272 2011 PRKX critically regulates endothelial cell proliferation, migration, and vascular-like structure formation.
20819953 2010 Regulation of cAMP-dependent protein kinases: the human protein kinase X (PrKX) reveals the role of the catalytic subunit alphaH-alphaI loop.
19576564 2009 Gene conversion between the X chromosome and the male-specific region of the Y chromosome at a translocation hotspot.
19367327 2009 Protein kinase-X interacts with Pin-1 and Polycystin-1 during mouse kidney development.
17980165 2008 Protein kinase X (PRKX) can rescue the effects of polycystic kidney disease-1 gene (PKD1) deficiency.
16491121 2006 Smad6 is a protein kinase X phosphorylation substrate and is required for HL-60 cell differentiation.
16236808 2005 Protein kinase X activates ureteric bud branching morphogenesis in developing mouse metanephric kidney.
15879576 2005 Profiles of PrKX expression in developmental mouse embryo and human tissues.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12082174 2002 PRKX, a phylogenetically and functionally distinct cAMP-dependent protein kinase, activates renal epithelial cell migration and morphogenesis.
10026146 1999 PrKX is a novel catalytic subunit of the cAMP-dependent protein kinase regulated by the regulatory subunit type I.
9860982 1998 A lineage-specific protein kinase crucial for myeloid maturation.
9302280 1997 Abnormal XY interchange between a novel isolated protein kinase gene, PRKY, and its homologue, PRKX, accounts for one third of all (Y+)XX males and (Y-)XY females.
9154127 1997 FISH localization of the human Y-homolog of protein kinase PRKX (PRKY) to Yp11.2 and two pseudogenes to 15q26 and Xq12-->q13.
7633447 1995 The human protein kinase gene PKX1 on Xp22.3 displays Xp/Yp homology and is a site of chromosomal instability.