Property Summary

Ligand Count 4
NCBI Gene PubMed Count 17
PubMed Score 28.68
PubTator Score 27.24

Knowledge Summary

Patent (4,444)

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 1.900 1.1e-02
atypical teratoid / rhabdoid tumor 1.400 4.3e-04
Breast cancer -1.200 1.1e-03
gastric carcinoma 1.800 1.2e-02
glioblastoma 1.200 2.3e-04
group 3 medulloblastoma 2.700 4.5e-04
lung cancer 1.300 2.3e-03
lung carcinoma -1.500 9.8e-24
medulloblastoma, large-cell 1.800 2.7e-05
oligodendroglioma 1.500 3.6e-03
ovarian cancer 2.200 7.5e-07
posterior fossa group A ependymoma 1.100 6.9e-05
primitive neuroectodermal tumor 2.000 4.2e-04
psoriasis 1.200 2.6e-03

 IMPC Phenotype (1)

Gene RIF (8)

AA Sequence

MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFDTLATVGTGTFGRVHLVKEKT      1 - 70
AKHFFALKVMSIPDVIRLKQEQHVHNEKSVLKEVSHPFLIRLFWTWHDERFLYMLMEYVPGGELFSYLRN     71 - 140
RGRFSSTTGLFYSAEIICAIEYLHSKEIVYRDLKPENILLDRDGHIKLTDFGFAKKLVDRTWTLCGTPEY    141 - 210
LAPEVIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILAGKIDFPRHLDFHVKDLIKKLLV    211 - 280
VDRTRRLGNMKNGANDVKHHRWFRSVDWEAVPQRKLKPPIVPKIAGDGDTSNFETYPENDWDTAAPVPQK    281 - 350
DLEIFKNF                                                                  351 - 358
//

Text Mined References (22)

PMID Year Title