Property Summary

NCBI Gene PubMed Count 42
PubMed Score 53.32
PubTator Score 37.00

Knowledge Summary

Patent (12,897)

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.400 6.0e-05
medulloblastoma, large-cell 2.200 3.9e-04
lung adenocarcinoma -1.900 3.0e-18
lung carcinoma -1.200 4.6e-08
acute myeloid leukemia -4.300 4.6e-02
ulcerative colitis -1.400 3.6e-05

Protein-protein Interaction (9)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (24)

PMID Text
26769964 The C-terminal cyclic nucleotide binding (CNB-B) domain of cGMP-dependent protein kinase II binds cGMP with higher affinity and selectivity when compared with its N-terminal CNB (CNB-A) domain.
26676300 PKG II inhibits EGFinduced activation of HER2 through binding with and causing threonine 686 phosphorylation of this oncogenic protein.
25688884 Han Chinese patients with rs10033237 polymorphism of cGKII/PRKG2 gene are more likely to suffer from gout.
25070890 we determined a crystal structure of the PKG II LZ-Rab11b complex. The PKG II LZ domain presents a mostly nonpolar surface onto which Rab11b docks, through van der Waals interactions
24882840 Our replication study suggests that cGKII is not involved in gout susceptibility.
24549567 PKGII inhibits RhoA activity by binding to this small GTPase and causing phosphorylation at its Ser188 site.
24534906 PKG II also inhibits the activation of the EGFR caused by diverse ligands of the receptor.
23404188 These data suggest that increased PKG II activity attenuates bFGFinduced proliferation and migration by inhibiting the MAPK/ERK signaling pathway, whereas PKG I does not
22940826 type II cGMPdependent protein kinase prevented the EGF-induced phosphorylation/activation of ERK and JNK, but not the phosphorylation of p38MAPK induced by EGF.
22791569 Downregulation of PKG2 was associated with malignant and benign breast tumors.
22556146 The work presented here demonstrates a novel antiproliferative and prodifferentiation role for PKG2 in the colon.
22427012 The results suggest that PKGII inhibits EGF-induced MAPK/JNK-mediated signal transduction and further confirmed that PKGII can block the activation of EGFR.
22303795 As an addition to PRKG2 and RASGEFIB genes, we propose to include BMP3 gene as the principal determinant of the observed common phenotype.
22012247 PKG II inhibits the proliferation of gastric cancer cells through blocking EGF-triggered MAPK signal transduction.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19543319 PRKG2 inhibits cell proliferation, Sox9 expression and Akt phosphorylation in human glioma cell lines.
19359370 Regulation of epithelial sodium channels by cGMP/PKGII.
19343178 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18678579 Results suggest that the cGK II gene on chromosome 4q21 is most likely to harbour gout disease independently of hyperuricaemia and is inherited recessively.
18678579 Observational study of gene-disease association. (HuGE Navigator)
18606955 Observational study of gene-disease association. (HuGE Navigator)
18262053 Characterization of the 4q21 breakpoint revealed PRKG2 as the likely gene partner to PDGFRB in myeloproliferative disorders.
12764134 results show that the fast phase of autophosphorylation of cGMP dependent protein kinase II has a small effect on its activity, whereas the secondary phase involving Ser126 phosphorylation may generate an active form
12054676 Inhibition of cGMP-dependent protein kinase II by its own splice isoform

AA Sequence

MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSKQTVAIAELTE      1 - 70
ELQNKCIQLNKLQDVVHMQGGSPLQASPDKVPLEVHRKTSGLVSLHSRRGAKAGVSAEPTTRTYDLNKPP     71 - 140
EFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDMVECMYGRNYQQGSYIIKQGEPGNHIFVLAE    141 - 210
GRLEVFQGEKLLSSIPMWTTFGELAILYNCTRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNF    211 - 280
LRSVSLLKNLPEDKLTKIIDCLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQ    281 - 350
KGEYFGEKALISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRS    351 - 420
MSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFAMKCIRKKHIV    421 - 490
DTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWSILRDRGSFDEPTSKFCVACV    491 - 560
TEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKKIGSGQKTWTFCGTPEYVAPEVILNKGHDFS    561 - 630
VDFWSLGILVYELLTGNPPFSGVDQMMTYNLILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKN    631 - 700
GINDIKKHRWLNGFNWEGLKARSLPSPLQRELKGPIDHSYFDKYPPEKGMPPDELSGWDKDF            701 - 762
//

Text Mined References (47)

PMID Year Title
26769964 2016 Structural Basis of Cyclic Nucleotide Selectivity in cGMP-dependent Protein Kinase II.
26676300 2016 Type II cGMP-dependent protein kinase directly inhibits HER2 activation of gastric cancer cells.
25688884 2015 Polymorphism of rs7688672 and rs10033237 in cGKII/PRKG2 and gout susceptibility of Han population in northern China.
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
25070890 2014 Crystal structure of the cGMP-dependent protein kinase II leucine zipper and Rab11b protein complex reveals molecular details of G-kinase-specific interactions.
24882840 2014 Common variants of cGKII/PRKG2 are not associated with gout susceptibility.
24549567 2014 Type II cGMP?dependent protein kinase inhibits RhoA activation in gastric cancer cells.
24534906 2014 Type II cGMP-dependent protein kinase inhibits ligand?induced activation of EGFR in gastric cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23449627 2013 Genome-wide association and longitudinal analyses reveal genetic loci linking pubertal height growth, pubertal timing and childhood adiposity.
23404188 2013 Type II, but not type I, cGMP-dependent protein kinase reverses bFGF-induced proliferation and migration of U251 human glioma cells.
22940826 2012 Type II cGMP-dependent protein kinase inhibits ERK/JNK-mediated activation of transcription factors in gastric cancer cells.
22791569 2012 Expression of cGMP-dependent protein kinase, PKGI?, PKGI?, and PKGII in malignant and benign breast tumors.
22556146 2012 Type 2 cGMP-dependent protein kinase regulates proliferation and differentiation in the colonic mucosa.
22427012 2012 Type II cGMP-dependent protein kinase inhibits EGF-induced MAPK/JNK signal transduction in breast cancer cells.
22303795 2011 8.6Mb interstitial deletion of chromosome 4q13.3q21.23 in a boy with cognitive impairment, short stature, hearing loss, skeletal abnormalities and facial dysmorphism.
22174851 2011 Genomewide association study for determinants of HIV-1 acquisition and viral set point in HIV-1 serodiscordant couples with quantified virus exposure.
22012247 2012 Type II cGMP-dependent protein kinase inhibits EGF-triggered signal transduction of the MAPK/ERK-mediated pathway in gastric cancer cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19543319 2009 Cyclic GMP-dependent protein kinase II inhibits cell proliferation, Sox9 expression and Akt phosphorylation in human glioma cell lines.
19359370 2009 Regulation of epithelial sodium channels by cGMP/PKGII.
19343178 2009 Meta-analysis of genome-wide scans for human adult stature identifies novel Loci and associations with measures of skeletal frame size.
18678579 2009 The cyclic GMP-dependent protein kinase II gene associates with gout disease: identified by genome-wide analysis and case-control study.
18606955 2008 Systematic analysis of glutamatergic neurotransmission genes in alcohol dependence and adolescent risky drinking behavior.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18262053 2008 Fusion of PRKG2 and SPTBN1 to the platelet-derived growth factor receptor beta gene (PDGFRB) in imatinib-responsive atypical myeloproliferative disorders.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16990611 2007 IRAG mediates NO/cGMP-dependent inhibition of platelet aggregation and thrombus formation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15555551 2004 The human pituitary nitroproteome: detection of nitrotyrosyl-proteins with two-dimensional Western blotting, and amino acid sequence determination with mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12764134 2003 Autophosphorylation of cGMP-dependent protein kinase type II.
12571245 2003 Actin binding of human LIM and SH3 protein is regulated by cGMP- and cAMP-dependent protein kinase phosphorylation on serine 146.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12054676 2002 Inhibition of cGMP-dependent protein kinase II by its own splice isoform.
11278298 2001 Phosphorylation and regulation of G-protein-activated phospholipase C-beta 3 by cGMP-dependent protein kinases.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10531334 1999 Serine 19 of human 6-pyruvoyltetrahydropterin synthase is phosphorylated by cGMP protein kinase II.
9535793 1998 Characterization of the gene encoding the human type II cGMP-dependent protein kinase.
8636133 1996 N-terminal myristoylation is required for membrane localization of cGMP-dependent protein kinase type II.
8607838 1996 Molecular cloning, cDNA structure, and chromosomal localization of the human type II cGMP-dependent protein kinase.
7543493 1995 Endogenous expression of type II cGMP-dependent protein kinase mRNA and protein in rat intestine. Implications for cystic fibrosis transmembrane conductance regulator.
7498513 1995 Expression of the human cGMP-dependent protein kinase II gene is lost upon introduction of SV40 T antigen or immortalization in human cells.
7493990 1995 Structural and functional consequences of mutations in 6-pyruvoyltetrahydropterin synthase causing hyperphenylalaninemia in humans. Phosphorylation is a requirement for in vivo activity.
6547441 1984 Phosphorylation of mammalian myosin light chain kinases by the catalytic subunit of cyclic AMP-dependent protein kinase and by cyclic GMP-dependent protein kinase.