Property Summary

NCBI Gene PubMed Count 140
PubMed Score 418.83
PubTator Score 463.16

Knowledge Summary

Patent (109,670)

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma -2.100 9.3e-07
osteosarcoma 1.885 8.5e-06
posterior fossa group B ependymoma 1.700 8.7e-11
cystic fibrosis 2.220 1.3e-06
group 4 medulloblastoma -1.700 1.6e-05
adrenocortical carcinoma -1.471 3.3e-03
non-small cell lung carcinoma -1.200 8.7e-25
intraductal papillary-mucinous adenoma (... -1.100 7.2e-03
intraductal papillary-mucinous carcinoma... -1.500 1.8e-03
intraductal papillary-mucinous neoplasm ... -1.500 1.0e-02
colon cancer -2.300 9.8e-06
lung cancer -2.900 1.2e-04
lung adenocarcinoma -1.500 1.0e-15
lung carcinoma -1.300 2.3e-09
ovarian cancer -2.500 4.0e-09
pituitary cancer -1.100 1.1e-03

Protein-protein Interaction (3)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (93)

PMID Text
26370085 cAMP is a partial agonist for PKG, and we elucidate the mechanism for cAMP partial agonism through the comparative NMR analysis of the apo, cGMP-, and cAMP-bound forms of the PKG cyclic nucleotide-binding domain B.
26132214 The C42-C42' disulfide bond dramatically stabilizes PRKG1.
25900831 Protein kinase G has a role in regulating production of H2S, which governs oxygen sensing
25855081 The Golgi apparatus regulates PKGIalpha compartmentation and proteolysis.
25447536 miR-20a expression is up-regulated in response to hypoxia in both mouse and human pulmonary arterial smooth muscle cells
25338677 Study of genetic heterogeneity in systemic lupus erythematosus, the top associations in European ancestry were protein kinase, cyclic GMP-dependent, type I (PRKG1) rs7897633 (P(Meta) = 2.75 x 10(-8)) and purine nucleoside phosphorylase (PNP) rs1049564 (P(Meta) = 1.24 x 10(-7)).
25273530 Expression levels of miR-517a-3p and its target mRNA PRKG1 were inversely correlated in NK cells before and after obstetric delivery.
25271401 Neutron diffraction reveals hydrogen bonds critical for cGMP-selective activation: insights for cGMP-dependent protein kinase agonist design.
24826884 Data show that functional cGMP/protein kinase G type 1 (PKG1) is expressed in pancreatic adenocarcinoma cells.
24666322 HIV-1 Tat potentiates NMDA-evoked (Ca2+)I responses involve LRP and a Src family kinase via the NOS/sGC/PKG pathway
24469460 nitration of Tyr(247) and the attenuation of cGMP binding is an important mechanism regulating in PKG-1alpha activity and SMC proliferation/differentiation
24239458 Leucine296 and Arginine297 are key residues of PKG I that mediate cGMP selectivity.
24060898 left ventricular systolic radial function was associated with common polymorphisms in PRKG1.
24060892 These findings indicate that PRKG1 risk alleles associate with salt-sensitivity related to a loss of the inhibitory control of renal Na(+) reabsorption, suggestive of a blunt pressure-natriuresis response.
23910461 Recurrent gain-of-function mutation in PRKG1 causes thoracic aortic aneurysms and acute aortic dissections.
23876037 Authors show for the first time that PKG is also able to stably interact with a viral substrate, West Nile virus NS5, in cell culture and in vitro.
23831687 activation of PKGI with cGMP regulated SSG1 intracellular distribution.
23814119 ANP attenuates the inflammatory actions of histamine via endothelial GC-A/cGMP/cGKI signaling and inhibitory phosphorylation of TRPC6 channels.
23770744 PKG positively regulates proteasome activities and proteasome-mediated degradation of misfolded proteins, likely through posttranslational modifications to proteasome subunits.
23755100 These findings characterize PKG as a novel regulator of AR-mediated transcription by enhancing AR cofactor p44/WDR77's function.
23686857 overexpression of PCs, furin and PC5, but not PC7, which are all expressed in SMC, increase PKGI cleavage in a dose-dependent manner
23418348 The data suggest that PKGIbeta enhances breast cancer cell motility and invasive capacity, at least in part, by phosphorylating CaD.
23416533 Studies indicate the presence of the switch helix (SW), a novel motif that promotes the formation of a domain-swapped dimer in the asymmetric unit.
23404188 These data suggest that increased PKG II activity attenuates bFGFinduced proliferation and migration by inhibiting the MAPK/ERK signaling pathway, whereas PKG I does not
23195829 The cyclic GMP-dependent kinase Ialpha -induced RhoA activation is dependent on the activity of ROCK and serine/threonine phosphatases.
23066013 RhoA is a PKGIalpha target and direct binding of activated PKGIalpha to RhoA is central to cGMP-mediated inhibition of the VSMC Rho kinase contractile pathway
22806632 Low myocardial PKG activity in heart failure with preserved ejection fraction was associated with raised cardiomyocyte F(passive) and was related to increased myocardial nitrosative/oxidative stress.
22791569 Downregulation of PKG1 was associated with malignant and benign breast tumors.
22580283 These results suggest that DAPK2 is one of the targets of cGK-I in apoptosis induction.
22293199 cGMP-dependent protein kinase (PKG) Ialpha transfection significantly attenuated the hypoxia-induced down-regulation of the expressions of SM-alpha-actin, MHC and calponin.
22095901 PKGIbeta inhibited cell growth and inducd apoptosis in breast cancer cells.
21697861 found in smooth muscle wall of blood vessels transversing the clitoral supepithelial and stromal space
21563174 Cyclic 3',5'-guanosine monophosphate-dependent protein kinase inhibits colon cancer cell adaptation to hypoxia.
21526164 The mechanism of cyclic nucleotide binding to PKG was investigated by determining crystal structures of the amino-terminal cyclic nucleotide-binding domain (CNBD-A) of human PKG I bound to either cGMP or cAMP.
21479273 The novel cGMP/PKG/ROS/calmodulin/CaMKII signaling pathway may regulate cardiomyocyte excitability by opening K(ATP) channels and contribute to cardiac protection against ischemia-reperfusion injury.
21451103 data suggest that activation of PKG signaling in pericytes inhibits focal adhesion formation by inhibiting Rac1
21414799 NO, depending on its concentration, may act in human PBMCs as a stimulator of IL-6 expression and modulator of NF-KB involving the sGC/cGMP/PKG pathway
21402151 cGMP dependent kinase 1 alpha interacts with and phosphorylates transient receptor potential cation channel subfamily C member 7
21160032 A novel mechanism has been elucidated that is able to increase PKG-I protein content in contractile cells, with hypotensive consequences in rat thoracic aorta.
20826808 structure provides molecular details of this unique leucine/isoleucine zipper, revealing specific hydrophobic and ionic interactions that mediate dimerization and demonstrating the topology of the GKAP interaction surface.
20732627 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20600009 iNOS acts as a molecular switch for the heterogeneous effects of microgravity on macrovascular, endocardial and microvascular endothelial cells via the cyclic guanosine monophosphate (cGMP)-PKG dependent pathway.
20567233 disruption of the IP3R1-IRAG calcium regulation system is a novel cause of dysfunctional osteoclasts unrelated to defects in attachment proteins or acid secretion
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20371672 The data suggest an important role of Src/PKG-Ialpha interaction in promoting DNA synthesis/cell proliferation in human ovarian cancer cells.
20348951 PKG inhibits TCF signaling in colon cancer cells by blocking beta-catenin expression and activating FOXO4.
20198315 Observational study of gene-disease association. (HuGE Navigator)
20182759 Observational study of gene-disease association. (HuGE Navigator)
20068229 Stduies indicate that cGMP-dependent protein kinase I modulates the RhoA-ROCK pathway and insulin receptor signaling to elicit BAT differentiation and stimulate thermogenesis.
20043968 PKG-Ialpha directly phosphorylates Bad at ser155, which may participate anti-apoptotic/cytoprotective effects in neural cells
20006992 Observational study of gene-disease association. (HuGE Navigator)
19996273 Data show that SS increased intracellular cGMP levels and activated protein kinase G, and selectively inhibited PDE5 in breast tumor cells.
19961855 PDE5-inhibition blocks TRPC6 channel activation and associated Cn/NFAT activation signaling by PKG-dependent channel phosphorylation
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851296 Observational study of gene-disease association. (HuGE Navigator)
19656393 These findings provide evidence of a physical and compartmentalized association between SERT and PKGIalpha that supports.
19487814 loss of caveolin-1 leads to hyperactive eNOS and subsequent tyrosine nitration-dependent impairment of PKG activity, which results in pulmonary hypertension.
19424179 cGKI has a dual function in BMP signalling: (1) it modulates BMP receptor/Smad activity at the plasma membrane and (2) after redistribution to the nucleus, it further regulates transcription as a nuclear co-factor for Smads.
19023132 PKG phosphorylates the N2-B and N2-A domains of titin.
19023099 Observational study of gene-disease association. (HuGE Navigator)
18983522 resulting in a dose- and time-dependent increase in phospho-VASP
18945831 IFN-gamma exerted a delayed suppressive effect on K(+) channels by enhancing iNOS expression and an acute stimulatory effect, which was independent of either NO pathways or phosphorylation mediated by PKA, PKG, and PI3K in renal proximal tubule cells.
18782776 analysis of the interaction between the coiled coil leucine zipper of cGMP-dependent protein kinase Ialpha and the C terminus of the myosin binding subunit of the myosin light chain phosphatase
18757735 PDE5 inhibition can differentially impact selected cellular functions of platelets, and perhaps of other cell types
18617565 These results strongly suggest that TRPC6 channels can be negatively regulated by the nitric oxide-cyclic GMP-protein kinase G pathway, probably via T69 phosphorylation of the N-terminal.
18593937 Activation of protein kinase G Increases the expression of p21CIP1, p27KIP1, and histidine triad protein 1 through Sp1.
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18496125 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18194177 Presence of cGKI alpha and beta provides further evidence for a significant role of these enzymes in the control of smooth muscle function in human penile erectile tissue.
17975119 Observational study of gene-disease association. (HuGE Navigator)
17904578 the leucine-zipper motif of PKG binds to that of MYPT1 to form a heterodimer; when the leucine-zipper motif of MYPT1 is absent, the PKG leucine-zipper motif binds to the coiled coil region and upstream segments of MYPT1 via formation of a heterotetramer
17601797 PKGI interacts with tripartite motif (TRIM) protein TRIM39R. TRIM proteins, through diverse molecular pathways, are often observed to regulate important aspects of cellular homeostasis.
16632465 cGMP-dependent protein kinase expression is regulated by Rho and Kruppel-like transcription factor-4
16407222 regulatory domains of cGMP-dependent protein kinase Ialpha and Ibeta retain dimerization and native cGMP-binding properties and undergo isoform-specific conformational changes
16385451 Observational study of gene-disease association. (HuGE Navigator)
16331690 Data suggest an important role of PKG in the PMA-induced inhibition of TRPC channels in native endothelial cells.
16249377 Nitric oxide affects dendritic cell migration through the activation of cGMP kinase.
16166082 cGMP-dependent protein kinase Ibeta binds to TFII-I and IRAG through a common interaction motif
16131665 high-resolution structure of the coiled-coil domain of cGMP-dependent protein kinase Ialpha
15917860 Observational study of gene-disease association. (HuGE Navigator)
15711749 Rap 1-GTP levels in platelets were reduced by NO-donors and activators of NO-sensitive soluble guanylyl cyclase
15556942 CD38 is stimulated by sequential activation of IL8 receptor, IP(3)-mediated Ca(2+) rise, and cGMP/protein kinase G and plays an essential role in IL8-induced migration of LAK cells
15280395 PKG has a role in platelet secretion
15051728 cyclic GMP-dependent protein kinase I binds to FHOD1 in vascular smooth muscle cells
14679200 G-kinase regulates vasodilator-stimulated phosphoprotein activity
12933804 dimerization of cGMP-dependent protein kinase Ibeta is mediated by an extensive amino-terminal leucine zipper motif, and dimerization modulates enzyme function
12855709 NPRA-PKG association may have a role in compartmentation of cGMP-mediated signaling and regulation of receptor sensitivity
12609995 PKG was found to be a target for phorbol 12-myristate 13-acetate (PMA)-responsive protein kinase C (PKC)
12574812 PKG appears to be solicited for P-selectin expression when cAMP levels are elevated which suggest a cAMP/PKG-dependent pathway of platelet activation.
12119292 inhibits serum-response element-dependent transcription by inhibiting rho activation and functions
12082086 G-kinase I beta interacted specifically with TFII-I, an unusual transcriptional regulator that associates with multiple proteins to modulate both basal and signal-induced transcription
11884369 Sp1 binding activity on the PKG-Ialpha promoter was detected ... and this binding was inhibited by NO and cyclic nucleotides; PKG-Ialpha gene expression is driven by an Sp1 transcription mechanism

AA Sequence

MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTRAQGISAEPQT      1 - 70
YRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLV     71 - 140
YVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHT    141 - 210
EYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVF    211 - 280
LRTLGKGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAA    281 - 350
FFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF    351 - 420
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGIIYRDLKPENL    421 - 490
ILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISADYWSLGILMYELLTGSPPFSG    491 - 560
PDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKG    561 - 630
TLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF                                 631 - 671
//

Text Mined References (149)

PMID Year Title
26370085 2015 Mechanism of cAMP Partial Agonism in Protein Kinase G (PKG).
26132214 2015 Structures of cGMP-Dependent Protein Kinase (PKG) I? Leucine Zippers Reveal an Interchain Disulfide Bond Important for Dimer Stability.
25900831 2015 Protein kinase G-regulated production of H2S governs oxygen sensing.
25855081 2015 The Golgi apparatus regulates cGMP-dependent protein kinase I compartmentation and proteolysis.
25447536 2014 MiR-20a regulates the PRKG1 gene by targeting its coding region in pulmonary arterial smooth muscle cells.
25416956 2014 A proteome-scale map of the human interactome network.
25342443 2014 Genome-wide association study identifies multiple loci associated with both mammographic density and breast cancer risk.
25338677 Genetic analysis of the pathogenic molecular sub-phenotype interferon-alpha identifies multiple novel loci involved in systemic lupus erythematosus.
25273530 2014 Human exosomal placenta-associated miR-517a-3p modulates the expression of PRKG1 mRNA in Jurkat cells.
25271401 2014 Neutron diffraction reveals hydrogen bonds critical for cGMP-selective activation: insights for cGMP-dependent protein kinase agonist design.
24826884 2014 Interlude of cGMP and cGMP/protein kinase G type 1 in pancreatic adenocarcinoma cells.
24469460 2014 Nitration of tyrosine 247 inhibits protein kinase G-1? activity by attenuating cyclic guanosine monophosphate binding.
24239458 2014 Structural basis for cyclic-nucleotide selectivity and cGMP-selective activation of PKG I.
24060898 2013 Left ventricular radial function associated with genetic variation in the cGMP-dependent protein kinase.
24060892 2013 cGMP-dependent protein kinase 1 polymorphisms underlie renal sodium handling impairment.
23910461 2013 Recurrent gain-of-function mutation in PRKG1 causes thoracic aortic aneurysms and acute aortic dissections.
23876037 2013 West Nile virus methyltransferase domain interacts with protein kinase G.
23831687 2013 Steroid-sensitive gene 1 is a novel cyclic GMP-dependent protein kinase I substrate in vascular smooth muscle cells.
23814119 2013 Atrial natriuretic peptide-mediated inhibition of microcirculatory endothelial Ca2+ and permeability response to histamine involves cGMP-dependent protein kinase I and TRPC6 channels.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23770744 2013 Protein kinase g positively regulates proteasome-mediated degradation of misfolded proteins.
23755100 2014 cGMP-dependent protein kinase I? interacts with p44/WDR77 to regulate androgen receptor-driven gene expression.
23686857 2013 Proprotein convertases play an important role in regulating PKGI endoproteolytic cleavage and nuclear transport.
23418348 2013 cGMP-dependent protein kinase I? regulates breast cancer cell migration and invasion via interaction with the actin/myosin-associated protein caldesmon.
23416533 2013 The switch helix: a putative combinatorial relay for interprotomer communication in cGMP-dependent protein kinase.
23404188 2013 Type II, but not type I, cGMP-dependent protein kinase reverses bFGF-induced proliferation and migration of U251 human glioma cells.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23195829 2013 RhoGEF17, a Rho-specific guanine nucleotide exchange factor activated by phosphorylation via cyclic GMP-dependent kinase I?.
23066013 2012 Direct binding and regulation of RhoA protein by cyclic GMP-dependent protein kinase I?.
22806632 2012 Low myocardial protein kinase G activity in heart failure with preserved ejection fraction.
22791569 2012 Expression of cGMP-dependent protein kinase, PKGI?, PKGI?, and PKGII in malignant and benign breast tumors.
22580283 2012 cGMP-dependent protein kinase I promotes cell apoptosis through hyperactivation of death-associated protein kinase 2.
22293199 2012 cGMP-dependent protein kinase I? transfection inhibits hypoxia-induced migration, phenotype modulation and annexins A1 expression in human pulmonary artery smooth muscle cells.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22095901 2012 Induction of apoptosis by type I? protein kinase G in the human breast cancer cell lines MCF-7 and MDA-MB-468.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21907864 2011 Identification of IL6R and chromosome 11q13.5 as risk loci for asthma.
21697861 Expression and distribution of key enzymes of the cyclic GMP signaling in the human clitoris: relation to phosphodiesterase type 5 (PDE5).
21563174 2011 Cyclic 3',5'-guanosine monophosphate-dependent protein kinase inhibits colon cancer cell adaptation to hypoxia.
21526164 2011 Co-crystal structures of PKG I? (92-227) with cGMP and cAMP reveal the molecular details of cyclic-nucleotide binding.
21479273 2011 Activation of cGMP-dependent protein kinase stimulates cardiac ATP-sensitive potassium channels via a ROS/calmodulin/CaMKII signaling cascade.
21451103 2011 Protein kinase G signaling disrupts Rac1-dependent focal adhesion assembly in liver specific pericytes.
21414799 2011 Nitric oxide affects IL-6 expression in human peripheral blood mononuclear cells involving cGMP-dependent modulation of NF-?B activity.
21402151 2011 Functional regulation of transient receptor potential canonical 7 by cGMP-dependent protein kinase I?.
21269460 2011 Initial characterization of the human central proteome.
21160032 2011 Fibronectin upregulates cGMP-dependent protein kinase type I? through C/EBP transcription factor activation in contractile cells.
20826808 2010 A crystal structure of the cyclic GMP-dependent protein kinase I{beta} dimerization/docking domain reveals molecular details of isoform-specific anchoring.
20732627 2010 Case-control genome-wide association study of attention-deficit/hyperactivity disorder.
20716671 2010 cGMP-dependent protein kinases and cGMP phosphodiesterases in nitric oxide and cGMP action.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20600009 2010 Simulated microgravity promotes nitric oxide-supported angiogenesis via the iNOS-cGMP-PKG pathway in macrovascular endothelial cells.
20567233 2010 Functional osteoclast attachment requires inositol-1,4,5-trisphosphate receptor-associated cGMP-dependent kinase substrate.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20371672 2010 Protein kinase G type Ialpha activity in human ovarian cancer cells significantly contributes to enhanced Src activation and DNA synthesis/cell proliferation.
20348951 2010 PKG inhibits TCF signaling in colon cancer cells by blocking beta-catenin expression and activating FOXO4.
20198315 2010 Association of genetic variants with hemorrhagic stroke in Japanese individuals.
20182759 2010 Fine mapping of the chromosome 10q11-q21 linkage region in Alzheimer's disease cases and controls.
20068229 2010 Cyclic nucleotides converge on brown adipose tissue differentiation.
20043968 2010 Protein kinase G type-Ialpha phosphorylates the apoptosis-regulating protein Bad at serine 155 and protects against apoptosis in N1E-115 cells.
20006992 2010 Correlation of a set of gene variants, life events and personality features on adult ADHD severity.
19996273 2009 Sulindac sulfide selectively inhibits growth and induces apoptosis of human breast tumor cells by phosphodiesterase 5 inhibition, elevation of cyclic GMP, and activation of protein kinase G.
19961855 2010 Cyclic GMP/PKG-dependent inhibition of TRPC6 channel activity and expression negatively regulates cardiomyocyte NFAT activation Novel mechanism of cardiac stress modulation by PDE5 inhibition.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19851296 2010 Assessment of a polymorphism of SDK1 with hypertension in Japanese Individuals.
19656393 2009 cGMP-dependent protein kinase Ialpha associates with the antidepressant-sensitive serotonin transporter and dictates rapid modulation of serotonin uptake.
19487814 2009 Persistent eNOS activation secondary to caveolin-1 deficiency induces pulmonary hypertension in mice and humans through PKG nitration.
19424179 2009 Novel crosstalk to BMP signalling: cGMP-dependent kinase I modulates BMP receptor and Smad activity.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19023132 2009 Protein kinase G modulates human myocardial passive stiffness by phosphorylation of the titin springs.
19023099 2009 Gene variants associated with ischemic stroke: the cardiovascular health study.
18983522 2008 Globular adiponectin increases cGMP formation in blood platelets independently of nitric oxide.
18945831 2009 Delayed and acute effects of interferon-gamma on activity of an inwardly rectifying K+ channel in cultured human proximal tubule cells.
18782776 2008 Probing the interaction between the coiled coil leucine zipper of cGMP-dependent protein kinase Ialpha and the C terminus of the myosin binding subunit of the myosin light chain phosphatase.
18757735 2008 Compartmentation and compartment-specific regulation of PDE5 by protein kinase G allows selective cGMP-mediated regulation of platelet functions.
18617565 2008 Nitric oxide-cGMP-protein kinase G pathway negatively regulates vascular transient receptor potential channel TRPC6.
18593937 2008 Activation of protein kinase G Increases the expression of p21CIP1, p27KIP1, and histidine triad protein 1 through Sp1.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18496125 2008 Interactions among genetic variants from contractile pathway of vascular smooth muscle cell in essential hypertension susceptibility of Chinese Han population.
18194177 2008 Expression and distribution of cyclic GMP-dependent protein kinase-1 isoforms in human penile erectile tissue.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17975119 2008 Association of gene variants with incident myocardial infarction in the Cardiovascular Health Study.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17904578 2007 Interactions between the leucine-zipper motif of cGMP-dependent protein kinase and the C-terminal region of the targeting subunit of myosin light chain phosphatase.
17601797 2007 cGMP-dependent protein kinase I interacts with TRIM39R, a novel Rpp21 domain-containing TRIM protein.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16990611 2007 IRAG mediates NO/cGMP-dependent inhibition of platelet aggregation and thrombus formation.
16632465 2006 Regulation of cGMP-dependent protein kinase expression by Rho and Kruppel-like transcription factor-4.
16407222 2006 Isolated regulatory domains of cGMP-dependent protein kinase Ialpha and Ibeta retain dimerization and native cGMP-binding properties and undergo isoform-specific conformational changes.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16331690 2006 Protein kinase C can inhibit TRPC3 channels indirectly via stimulating protein kinase G.
16249377 2006 Nitric oxide and cGMP protein kinase (cGK) regulate dendritic-cell migration toward the lymph-node-directing chemokine CCL19.
16166082 2005 Identification of the interface between cGMP-dependent protein kinase Ibeta and its interaction partners TFII-I and IRAG reveals a common interaction motif.
16131665 2005 Rapid and accurate structure determination of coiled-coil domains using NMR dipolar couplings: application to cGMP-dependent protein kinase Ialpha.
15917860 2005 Lack of association between polymorphism of the human cyclic GMP-dependent protein kinase gene and obesity.
15851553 2005 The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts.
15711749 2005 The NO/cGMP pathway inhibits Rap 1 activation in human platelets via cGMP-dependent protein kinase I.
15632203 2005 Rap1GAP2 is a new GTPase-activating protein of Rap1 expressed in human platelets.
15556942 2005 Activation of CD38 by interleukin-8 signaling regulates intracellular Ca2+ level and motility of lymphokine-activated killer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15280395 2004 A platelet secretion pathway mediated by cGMP-dependent protein kinase.
15194681 2004 Smooth muscle phosphatase is regulated in vivo by exclusion of phosphorylation of threonine 696 of MYPT1 by phosphorylation of Serine 695 in response to cyclic nucleotides.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15107017 2004 Phosphorylation of septin 3 on Ser-91 by cGMP-dependent protein kinase-I in nerve terminals.
15051728 2004 Formin homology domain protein (FHOD1) is a cyclic GMP-dependent protein kinase I-binding protein and substrate in vascular smooth muscle cells.
14983059 2004 Regulation of canonical transient receptor potential isoform 3 (TRPC3) channel by protein kinase G.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14679200 2004 Vasodilator-stimulated phosphoprotein activation of serum-response element-dependent transcription occurs downstream of RhoA and is inhibited by cGMP-dependent protein kinase phosphorylation.
14608379 2003 Regulator of G-protein signaling-2 mediates vascular smooth muscle relaxation and blood pressure.
14532276 2003 Characterization of recombinant skeletal muscle (Ser-2843) and cardiac muscle (Ser-2809) ryanodine receptor phosphorylation mutants.
12933804 2003 Dimerization of cGMP-dependent protein kinase Ibeta is mediated by an extensive amino-terminal leucine zipper motif, and dimerization modulates enzyme function.
12855709 2003 Atrial natriuretic peptide induces natriuretic peptide receptor-cGMP-dependent protein kinase interaction.
12609995 2003 Activation of cGMP-dependent protein kinase by protein kinase C.
12574812 2003 Differential regulation of P-selectin expression by protein kinase A and protein kinase G in thrombin-stimulated human platelets.
12571245 2003 Actin binding of human LIM and SH3 protein is regulated by cGMP- and cAMP-dependent protein kinase phosphorylation on serine 146.
12480535 2003 Association of phospholamban with a cGMP kinase signaling complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12237340 2002 Activation of the mitogen activated protein kinase extracellular signal-regulated kinase 1 and 2 by the nitric oxide-cGMP-cGMP-dependent protein kinase axis regulates the expression of matrix metalloproteinase 13 in vascular endothelial cells.
12175859 Phosphorylation of the recombinant rho1 GABA receptor.
12119292 2002 cGMP-dependent protein kinase inhibits serum-response element-dependent transcription by inhibiting rho activation and functions.
12082086 2002 cGMP-dependent protein kinase I beta physically and functionally interacts with the transcriptional regulator TFII-I.
11723116 2002 Regulation of cGMP-specific phosphodiesterase (PDE5) phosphorylation in smooth muscle cells.
11309393 2001 Molecular determinants of the interaction between the inositol 1,4,5-trisphosphate receptor-associated cGMP kinase substrate (IRAG) and cGMP kinase Ibeta.
11278298 2001 Phosphorylation and regulation of G-protein-activated phospholipase C-beta 3 by cGMP-dependent protein kinases.
11175347 2000 NO activation of fos promoter elements requires nuclear translocation of G-kinase I and CREB phosphorylation but is independent of MAP kinase activation.
11162591 2001 cGMP-dependent protein kinase phosphorylates and inactivates RhoA.
10922374 2000 KT5823 inhibits cGMP-dependent protein kinase activity in vitro but not in intact human platelets and rat mesangial cells.
10851246 2000 Regulation of human endothelial cell focal adhesion sites and migration by cGMP-dependent protein kinase I.
10724174 2000 Regulation of intracellular calcium by a signalling complex of IRAG, IP3 receptor and cGMP kinase Ibeta.
10681529 2000 Cysteine-rich protein 2, a novel substrate for cGMP kinase I in enteric neurons and intestinal smooth muscle.
10671526 2000 Binding and phosphorylation of a novel male germ cell-specific cGMP-dependent protein kinase-anchoring protein by cGMP-dependent protein kinase Ialpha.
10601315 1999 A novel interaction of cGMP-dependent protein kinase I with troponin T.
10567269 1999 Regulation of myosin phosphatase by a specific interaction with cGMP- dependent protein kinase Ialpha.
10449420 1999 Phosphorylation of splicing factor SF1 on Ser20 by cGMP-dependent protein kinase regulates spliceosome assembly.
10051666 1999 Molecular identification of human G-substrate, a possible downstream component of the cGMP-dependent protein kinase cascade in cerebellar Purkinje cells.
9829964 1998 CREB is a regulatory target for the protein kinase Akt/PKB.
9687510 1998 Mitogen- and stress-activated protein kinase-1 (MSK1) is directly activated by MAPK and SAPK2/p38, and may mediate activation of CREB.
9192852 1997 Characterization of the human gene encoding the type I alpha and type I beta cGMP-dependent protein kinase (PRKG1).
8688081 1996 Coupling of the RAS-MAPK pathway to gene activation by RSK2, a growth factor-regulated CREB kinase.
8663267 1996 Phosphorylation of purified bovine bone sialoprotein and osteopontin by protein kinases.
8613202 1996 cDNA cloning and gene expression of human type Ialpha cGMP-dependent protein kinase.
8380342 1993 Phosphorylation of serine 2843 in ryanodine receptor-calcium release channel of skeletal muscle by cAMP-, cGMP- and CaM-dependent protein kinase.
8182057 1994 cAMP- and cGMP-dependent protein kinase phosphorylation sites of the focal adhesion vasodilator-stimulated phosphoprotein (VASP) in vitro and in intact human platelets.
8132598 1994 Phosphorylation of the inositol 1,4,5-trisphosphate receptor by cyclic GMP-dependent protein kinase.
7589584 1995 Expression, purification, and characterization of the cGMP-dependent protein kinases I beta and II using the baculovirus system.
2792381 1989 Molecular cloning and predicted full-length amino acid sequence of the type I beta isozyme of cGMP-dependent protein kinase from human placenta. Tissue distribution and developmental changes in rat.
1544322 1992 Localization of the human gene for the type I cyclic GMP-dependent protein kinase to chromosome 10.
1377674 1992 Phosphorylation of the cystic fibrosis transmembrane conductance regulator.