Property Summary

NCBI Gene PubMed Count 348
PubMed Score 693.71
PubTator Score 928.47

Knowledge Summary

Patent (17,380)

Expression

  Differential Expression (15)

Disease log2 FC p
psoriasis -1.200 2.7e-03
osteosarcoma 1.852 5.8e-04
glioblastoma 1.100 2.7e-05
group 3 medulloblastoma 1.500 9.4e-04
astrocytoma 1.700 4.4e-03
medulloblastoma, large-cell 2.000 1.6e-06
acute quadriplegic myopathy 1.628 2.7e-08
non-small cell lung cancer 1.742 1.2e-17
intraductal papillary-mucinous neoplasm ... 1.600 5.3e-03
lung cancer 1.600 6.4e-05
colon cancer 1.200 1.1e-05
nasopharyngeal carcinoma 1.700 2.9e-04
lung adenocarcinoma 1.864 2.3e-06
breast carcinoma 1.100 2.7e-12
ovarian cancer 2.200 1.3e-03

Gene RIF (263)

PMID Text
26992638 Transient knockdown of PRKDC reduced cell proliferation/survival in HCT116 and DLD1, but not FHC cells. PRKDC down-regulation induced apoptosis partially through inhibiting AKT activation, and sensitized HCT116 cells to chemotherapeutic agents
26990988 The ends are then closely aligned, which requires XLF, a non-catalytic function of XRCC4-LIG4, and DNA-PK activity
26774662 These results provide new evidence linking cell cycle to bystander responses and demonstrate that DNA-PKcs and ATM are two associated factors in co-regulating G2-M phase-related bystander effects.
26772202 Results show that under hypoxia, Ku70 and DNA-PKcs interact with nuclear RON which activates non-homologous end joining DNA repair conferring chemoresistance.
26652902 CDK2 and DNA-PK regulate PR transcriptional activity by distinct mechanisms.
26603896 suggested that DNA-PK and PARP-dependent recruitment of XRCC1 is necessary to effectively protect, repair, and restart stalled replication forks, providing new insight into how genomic stability is preserved
26578593 Data show that inhibition of DNA-dependent protein kinase catalytic subunit (DNA-PK) prevents type I DNA topoisomerase (Top1) degradation and proteasome activity in camptothecin (CPT)-treated quiescent WI38 cells.
26546606 protein deficiency impairs Ig class switch recombination
26464705 DNA methylation modification plays an important role to regulate the gene expression of XRCC5 and XRCC7, from the results that the gene methylation level of the glioma group is higher than that of the normal group
26365377 ATR inhibition induces moderate ssDNA and triggers a DNA-PK and Chk1-mediated backup pathway to suppress origin firing.
26175416 Results show that DNA-PKcs functions as a selective modulator of transcriptional networks that induce cell migration, invasion, and metastasis of prostate cancer cells.
26166223 A significantly different distribution was found in the frequency of PRKDC (rs7003908) genotype between the ESCC group and controls. Individuals homozygous for the C allele had a significant (3.185-fold) increased risk of ESCC.
26108997 Our study supported that DNA-PKcs was involved in drug-induced DNA damage repair and related to chemosensitivity of osteosarcoma MG63 cells
26065416 Results show that activated DNA-PKcs is elevated in medullary thyroid tumor samples and its expression correlates with expression of RET in thyroid tumors.
26057167 Kaposi's sarcoma-associated herpesvirus appears then to selectively activate DNA damage response pathways via the ATM and DNA-PK DNA damage response kinases.
26049366 c-Myc protein functions in the process of DNA double-strand break repair, at least partially, through affecting the ATM phosphorylation and DNA-PKcs kinase activity.
26017556 DNA-PKcs has a role in cancer metastasis through regulation of secreted proteins involved in migration and invasion
25944161 Our results suggested that the GG and GT genotypes of X-ray repair cross-complementing group 7 (XRCC7) G6721T had no effect on HCC risk to the whole population, but had a protective effect on HCC risk among males and alcohol drinkers.
25925375 Combined inhibition of DNA-PKcs and Plk1 can be employed in cancer therapy strategy for synthetic lethality.
25852083 DNA-PK directly phosphorylates NOR-1, modulating vascular smooth muscle cell proliferation.
25842288 Deficiency of AIRE partner, PRKDC, can present as an inflammatory disease with organ-specific autoimmunity, suggesting a role for PRKDC in regulating autoimmune responses and maintaining AIRE-dependent tolerance in human subjects.
25823795 Ectopic expression of miR-1323 significantly increased the survival fraction of irradiated cancer cells. Inhibition of miR-1323 reversed the radioresistance of cancer cells and subsequently suppressed the expression of miR-1323-regulated DNA-PKcs protein
25823028 CD133 and DNAPK regulate MDR1 via the PI3K- or Akt-NF-kappaB pathway in multidrug-resistant glioblastoma cells.
25815686 Treatment with the DNA-dependent protein kinase (DNA-PK) inhibitor significantly reduced gamma-H2AX foci formation (P<0.05) following acute radiation exposure in the radioresistant sub-clones, compared with the parental control cells
25771720 Critical role of DNA-PKcs for maintaining survival after radiation exposure which is uncoupled from its essential function in DSB repair.
25756210 Polymorphism in XRCC7 gene is associated with Systemic Lupus Erythematosus.
25749521 TNKS1BP1 has a role in DNA double-strand break repair though DNA-PKcs autophosphorylation which is dependent on PARP-1
25631074 Cellular biotinylated protein kinase, DNA-activated, catalytic polypeptide (PRKDC) protein is incorporated into HIV-1 Gag virus-like particles
25550082 In this review, we will describe the biochemistry, structure and function of DNA-PK, its roles in DNA double strand break repair and its newly described roles in mitosis and other cellular processes.
25503126 The GG and GT genotypes of XRCC7 rs7003908 compared to the TT genotype had a protective effect on lung cancer risk in Taiwan, particularly among males and smokers.
25495526 the synthetic lethality between PRKDC and MYC may in part be due to PRKDC dependent modulation of MYC expression, as well as MYC-induced DNA damage where PRKDC plays a key role in DNA damage repair.
25480831 we show increased PRKDC mRNA expression in hepatocellular carcinomas in association with amplification of the PRKDC locus.
25348361 DNA-PKcs suppression has complementary effects in combination with cisplatin and 5-Fu treatment in HepG2 cells.
25332688 Cellular biotinylated protein kinase, DNA-activated, catalytic polypeptide (PRKDC) protein is incorporated into HIV-1 Gag virus-like particles
25294801 Depletion of DNA-PKcs in glioblastoma cells at least partly suppressed ionizing radiation-inflicted migration, invasion, and tube formation.
25210793 Activated platelets accumulate in the brain rescue apoptotic neuron cells via activation of EGFR and DNA-dependent protein kinase.
25205036 BRCA1-BER deficient cells could be targeted by ATM or DNA-PKcs inhibitors for personalized therapy.
25078033 PRKDC proteins that mediate non-homologous end joining have been identified as TRIP13 binding partners in head and neck cancer.
25046228 loss of expression correlates with decreased survival in gall bladder malignancies patients
24844881 PLK1 phosphorylates DNA-PKcs on Ser3205 in vitro and interacts with DNA-PKcs in mitosis.
24819595 DNA-PK is critical in cell responses to replication stress. DNA-PK is the primary kinase targeting RPA32 Ser4/Ser8.
24680878 Following induction of a DNA double stranded breaks, daya show that DNA-PKcs is phosphorylated on multiple sites.
24662822 DNA-PK/Chk2 signaling induces centrosome amplification upon long-term HU treatment, therefore increasing our insight into tumor recurrence after initial chemotherapy.
24657168 IP7, formed by IP6K2, binds CK2 to enhance its phosphorylation of the Tti1/Tel2 complex, thereby stabilizing DNA-PKcs and ATM. This process stimulates p53 phosphorylation at serine 15 to activate the cell death program.
24535266 the current meta-analysis confirmed that the rs7003908 polymorphism in the XRCC7 gene might be a risk factor for prostate cancer.
24530422 EMSA and ChIP assay confirmed higher binding of Sp1 and Sp3 with DNA-PKcs 5'-promoter region of DNA-PKcs of K562/DNR than that of K562.
24485452 Identification of the DNA-damage-induced Golgi response reveals an unexpected pathway through DNA-PK, GOLPH3, and MYO18A that regulates cell survival following DNA damage.
24429382 Indicate that phosphorylation of Ser-440 and -467 in WRN by DNA-PK is important for relocalization of WRN to nucleoli, and that it is required for efficient DSB repair.
24365180 DNA-PKcs-mTORC2(SIN1) association is required for UVB-induced Akt Ser-473 phosphorylation and cell survival.
24321564 Cellular biotinylated protein kinase, DNA-activated, catalytic polypeptide (PRKDC) protein is incorporated into HIV-1 Gag virus-like particles
24321528 Cellular biotinylated protein kinase, DNA-activated, catalytic polypeptide (PRKDC) protein is incorporated into HIV-1 Gag virus-like particles
24220101 The Mre11-Rad50-Nbs1 (MRN) complex further stimulates resection in the presence of Ku and DNA-PKcs by recruiting Exo1 and enhancing DNA-PKcs autophosphorylation, and it also inhibits DNA ligase IV/XRCC4-mediated end rejoining.
24187467 Enhanced DNA-PKcs and Ku 70/80 expression may be closely associated with gastric carcinoma.
24166892 Data indicate that DNA-dependent protein kinase catalytic subunit (DNA-PKcs) interacts with polo-like kinase 1 (PLK1) in mitotic phase.
24136149 DNA-dependent protein kinase catalytic subunit transduces HSF1 effects in hepatocellular carcinoma cells, and might represent a novel target and prognostic factor.
24085291 interaction between DNA-PKcs and Snail1 might be an effective strategy for sensitizing cancer cells and inhibiting tumor migration
24013362 DNA-PKcs inhibition sensitizes cancer cells to carbon-ion irradiation via telomere capping disruption.
23897887 The synergistic activation of DNA-PKcs and ATR suggests that the two kinases combine to mount a prompt and specific response to replication-born DNA double-strand breaks (DSBs).
23775790 DNA damage-induced inhibition of rRNA synthesis is dependent on the activities of both DNA-PK and PARP-1.
23739334 Cellular biotinylated protein kinase, DNA-activated, catalytic polypeptide (PRKDC) protein is incorporated into HIV-1 Gag virus-like particles
23739328 Cellular biotinylated protein kinase, DNA-activated, catalytic polypeptide (PRKDC) protein is incorporated into HIV-1 Gag virus-like particles
23722905 A stringent requirement for functional PRKDC during human neuronal development.
23678292 Results provide a new insight into the mechanism of PIG3's functioning in DNA damage signaling and the regulation network of cellular DNA-PKcs expression homeostasis.
23603433 The FRA8I fragile site includes KIAA0146, CEBPD and PRKDC and may have a role in colorectal cancer
23505488 Inactivation of DNA-dependent protein kinase promotes heat-induced apoptosis independently of heat-shock protein induction in human cancer cell lines.
23449453 DNA-PKcs phosphorylates snail1 at ser100 led to increased snail 1 stability and inhibited the kinase activity of DNA-Pkcs.
23392706 Taken together, the findings reveal a central role of DNA-PKcs in hydroquinone-induced hematotoxicity in which it coordinates DNA DSB repair, cell cycle progression, and apoptosis.
23325849 Allosteric regulation of DNA-PK by DNA termini protruding from chromatin constitutes an autonomous mechanism for break-localized protein phosphorylation that generates sub-nuclear foci.
23325550 DNA-dependent protein kinase catalytic subunit is a novel interaction partner of lymphocyte enhancer factor 1.
23322783 Results show the N-terminal region mediates the interaction between DNA-PKcs and the Ku70/Ku80-DNA complex and is required for its DNA double-stranded breaks (DSBs)-induced enzymatic activity.
23204796 T allele of the G6721T polymorphism of XRCC7 increased the risk of ARMD among outdoor subjects.
23184344 Free fatty acids treatment did not increase DNA-PKcs mRNA expression levels in HepG2 cells.
23183621 Allele 3434Thr in XRCC7 gene might be associated with differentiated thyroid cancer risk.
23125841 Cellular biotinylated protein kinase, DNA-activated, catalytic polypeptide (PRKDC) protein is incorporated into HIV-1 Gag virus-like particles
23108991 XRCC7 rs7003908 polymorphism may contribute to cancer susceptibility for prostate cancer, which is recommended to be included in future large-sample studies and functional assays.
23098854 ERK reduces NHEJ-mediated repair of double strand breaks via attenuation of DNA-PKcs activation.
23098447 XRCC7 gene polymorphism is associated with breast cancer.
23001845 ATF4 and IRE1alpha inhibit DNA repair protein DNA-dependent protein kinase 1 induced by heat shock
22923485 The critical importance of a reciprocal relationship between DNA-PKcs phosphorylation and EGFR-mediated radiation response, was examined.
22825692 There was no significant association between G6721T polymorphism of XRCC7 and susceptibility to pre-eclampsia.
22815474 a novel role of nEGFR in radioresistance, and that is, upon ionizing radiation, nEGFR inactivates the ribonuclease activity of PNPase toward c-MYC mRNA through DNAPK-mediated Ser-776 phosphorylation
22753480 DNA-PK phosphorylates HSP90alpha on threonines 5 and 7 early during apoptosis and both phosphorylated HSP90alpha and DNA-PK colocalize in the apoptotic ring.
22634101 Using RFLP-PCR based method, the polymorphism of XRCC7 was determined. The TG (OR=1.20, 95% CI: 0.83-1.74, P=0.320) and TT (OR=1.01, 95% CI: 0.67-1.53, P=0.933) genotypes had no significant effect on risk of breast cancer
22499342 Mutations in MCM4/PRKDC represent a novel cause of DNA breakage and NK cell deficiency.
22343725 results point to the pivotal role of DNAPK activity in the eviction of RNAPII from DNA upon encountering a DNA lesion
22332739 protein kinase, DNA-activated catalytic polypeptide (PRKDC), was confirmed to play a role in MyD88-induced IFNA2 activation and IL-8 secretion
22310661 AIRE is recruited to tissue restricted antigens genes in chromatin via cooperative interactions with H3K4me0 and DNA-protein kinase
22298787 PP6 regulatory subunit R1 is bidentate anchor for targeting protein phosphatase-6 to DNA-dependent protein kinase.
22198295 These results suggest that p53 and DNA- PKcs independently function for tetraploid G1 arrest and preventing polyploidy formation.
22190353 DNA-PKCS negatively regulates p21 expression by directly interacting with the p21 transcription machinery via p53, driving the cell towards apoptosis.
22190034 Cellular biotinylated protein kinase, DNA-activated, catalytic polypeptide (PRKDC) protein is incorporated into HIV-1 Gag virus-like particles
22174317 Cellular biotinylated protein kinase, DNA-activated, catalytic polypeptide (PRKDC) protein is incorporated into HIV-1 Gag virus-like particles
22139836 Abeta mediates inhibition of the DNA-PK-dependent nonhomologous end joining pathway contributing to the accumulation of DSBs that, if not efficiently repaired, may lead to the neuronal loss observed in AD.
22131882 DNA-PK inhibition might prevent platinum-induced AKT activation without interfering with normal glucose homeostasis, an unwanted toxicity of direct AKT inhibitors.
22040967 DNA-PKcs expression level is closely related with the increased WBC count, karyotype and clinical prognosis in adult acute leukemia.
22027841 RAD50, DNA-PKcs kinase activity, and transcription context are each important to limit incorrect end use during EJ repair of multiple DSBs, but each has distinct roles during repair events requiring end processing
22009179 specific pharmacologic inhibition of DNA-PK, but not PI3K or mTORC1, delays DSB repair leading to accelerated senescence after radiation
21979916 NR4A functions directly at DNA repair sites by a process that requires phosphorylation by DNA-PK
21941773 DNA-PK might play a role in silica-induced alternations of cell cycle and regulate silica-induced overexpression of CyclinE in human embryo lung fibroblasts.
21905307 analysis of gene expression associated with DNA-dependent protein kinase activity under normoxia, hypoxia, and reoxygenation
21775006 Immunohistochemical staining intensities of PARP-1 and DNA-PK were determined (score 0-3) and expression levels were correlated with /glioblastoma multiforme patients overall survival.
21773671 The DNA-PKcs not only did not protect cells from either telomere instability or celluar effects induced by 360A but was involved in th severe mitotic impairments induced by the G-quadrulpex ligand.
21750982 Lack of DNA-PKcs is accompanied by an increase in the protein level of one of the catalytic isozymes of protein kinase CK2, i.e., CK2alpha' and a concomitant increase in CK2 activity.
21731742 RPA2 hyperphosphorylation by DNA-PK in response to DNA double-strand breaks blocks unscheduled homologous recombination and delays mitotic entry.
21723633 Data indicate that the function of DNA-PKcs on IR-induced Akt-S473 phosphorylation is cell line specific.
21679440 DNA-PK and FACT both play roles in DNA repair. Therefore both are putative targets for therapeutic inhibition.
21671477 Our finding suggests that polymorphisms in DNA repair genes, POLN and PRKDC, were associated with increased melanoma risk in melanoma families with and without CDKN2A mutations.
21576354 hypoxia initiates chromatin modification and consequently DNA-PK activation, which positively regulate cellular oxygen-sensing and oxygen-signalling pathways
21559021 DNA-PK activity of PBLs in advanced cancer was lower than in early stage; patients with lower DNA-PK activity tended to have lower disease-specific survival and distant metastasis-free survival than those with higher activity in advanced stages
21487018 a common biochemical mechanism exists for activation of DNA-PK, ATM, and ATR by bulky adduct-containing DNA.
21450944 DNA-PK interacts with the RNA polymerase II complex recruited at the human immunodeficiency virus (HIV) long terminal repeat and regulated HIV gene expression.
21450944 Cellular biotinylated protein kinase, DNA-activated, catalytic polypeptide (PRKDC) protein is incorporated into HIV-1 Gag virus-like particles
21330363 The results demonstrate for the first time that DNA-PKcs, in addition to its role in DSB repair, is a critical regulator of mitosis and could modulate microtubule dynamics in chromosome segregation.
21300785 here that certain phosphorylations of the DNA-PK large catalytic subunit (DNA-PKcs) clearly promote homologous recombination while inhibiting NHEJ
21214942 The depletion of DNA-PKcs mediated by siRNA significantly decreased the transcription-coupled repair capacity of repairing the UV-induced cyclobutane pyrimidine dimers damage in DHFR gene in HeLa cells.
21188139 DNA-PK enhances rAAV replication through the interaction of Ku proteins and AAV-ITRs
21175350 DNA-PKcs mutant cells defective in phosphorylation at multiple sites within the T2609 cluster or within the PI3K domain displayed extreme radiosensitivity.
21108935 Specific shRNA inhibition of DNA-PKcs in glioma-initiating cells induced autophagy and radiosensitized the cells.
21042724 Different roles of DNA-PKcs and Ku70/80 in repair and cell death regulation after DNA damage.
21037379 Tankyrase 1-PARP regulates stabilization of the NHEJ protein DNA-PKcs, revealing a new aspect of DNA-PKcs regulation that impacts both telomere and DNA repair functions.
20972425 The findings reveal a novel mechanism for targeted nitrosylation of DNAPK and suggest that protein-protein transfer of nitric oxide groups may be a general mechanism in cellular signal transduction.
20966071 a novel mechanism for the involvement of DNA-PK in the positive regulation of p50 NF-kappaB to drive VCAM-1 expression.
20878914 In rheumatoid arthritis, the DNA-PKcs-JNK-Bim/Bmf axis transmits genotoxic stress into shortened survival of naive resting T cells, imposing chronic proliferative turnover of the immune system and premature immunosenescence.
20813000 Meta-analysis of gene-disease association. (HuGE Navigator)
20711232 These results indicate that CK2 has an important role in the modulation of DNA-PKcs activity and its phosphorylation status providing important insights into the mechanisms by which DNA-PKcs is regulated in vivo.
20610542 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20590474 homologous recombination (XRCC3) and nonhomologous end-joining (XRCC7) genes and conferring predisposition to prostate cancer
20590474 Observational study of gene-disease association. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20219974 Data show that, upon estrogen stimulation, DNA-PK forms a complex with ERalpha in a breast cancer cell line (MELN).
20205745 DNA-PK(cs)directly phosphorylates H2AX independent of ATM and indirectly modulate the phosphorylation level of gamma H2AX via the Akt/GSK3 beta signal pathway.
20204287 there was no clear correlation between DNA-PK and radiation sensitivity in human ovarian carcinoma cell lines
20157594 SIRT6 associates dynamically with chromatin in response to DNA damage, and stabilizes the DNA double-strand break (DSB) repair factor, DNA-dependent protein kinase (DNA-PK), at DSBs.
20111054 analysis of transcriptional activation of DNA-dependent protein kinase catalytic subunit gene expression by oestrogen receptor-alpha
20065038 A novel function of DNA-PKcs is to recruit PP6 to sites of DNA damage and that PP6 contributes to the dephosphorylation of gamma-H2AX, the dissolution of ionizing radiation-induced foci, and release from the G(2)/M checkpoint in vivo.
20023628 crystal structure of human DNA-PKcs at 6.6 A resolution, in which the overall fold is clearly visible for the first time
20003485 Plays role in the 3'-processing reaction and protection of the ends of viral DNA (HIV-1) after reverse transcription. Involved in multiple steps including integration and pre-integration steps during retroviral replication.
19851285 Phosphorylation of tyrosyl-DNA phosphodiesterase (TDP1) at serine81 is mediated by the protein kinases ataxia-telangiectasia-mutated (ATM) and/or DNA-dependent protein kinase (DNA-PK).
19815090 XRCC7 G allele carriers (TG+GG) are also at an elevated risk for susceptibility to urothelial bladder cancer.
19815090 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19781633 findings indicate DNA-PK as an important enzyme maintaining the quiescent endothelial phenotype by actively inhibiting Akt thus restraining endothelial cell proliferation preventing excessive growth.
19773279 Observational study of gene-disease association. (HuGE Navigator)
19697154 BCR/ABL switch on backup non-homologous end joining (B-NHEJ) which is more error-prone thann DNA-PK(CS) D-NHEJ and in such manner contribute to the increase of the genomic instability of leukemic cells.
19672258 Residual tumours showed increased frequency of DNA-PKcs (P=0.037), Ku70 (P=0.018), Ku86 (P=0.008) positive cells. A correlation in DNA-PKcs expression between primary and residual tumours was found.
19624897 In non-small cell lung cancer cell lines higher expression of DNA-PKcs correlates with greater resistance to radiation.
19589246 These results suggest that abnormally low levels of PTEN, MGMT and DNA-PKcs protein in gynaecomastia breast tissue may play a role in the development of gynaecomastia.
19573080 Observational study of gene-disease association. (HuGE Navigator)
19467273 It appears that the HCV-core protein facilitates the degradation of Ku70 and reduces DNA-PK activity in noncancerous liver cells.
19451221 Experiments with DNA-PKcs-deficient cell lines and a specific DNA-PKcs inhibitor demonstrate that both the general repression of mRNA translation and the preferential translation of specific mRNAs depend on DNA-PKcs activity
19444312 ATM substrates involved in cell-cycle checkpoint signalling can be minimally phosphorylated independently by ATR, while a small subset of proteins involved in chromatin remodelling are phosphorylated by DNA-PKcs in addition to ATM.
19351595 hnRNP-U is phosphorylated at Ser59 by DNA-PK in vitro and in cells in response to DNA double-strand breaks.
19341095 DNA-dependent protein kinase modulates ribosomal RNA transcription
19237606 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19224683 DNA-PKcs might play a major role in silica-induced DNA double strand break repair. Silica-induced histone H2AX phosphorylation was dependent on DNA-PKcs.
19198648 Activation of DNA-PK by ionizing radiation is mediated by protein phosphatase 6
19181665 NRF-1 can also directly interact with poly(ADP-ribose) polymerase 1 (PARP-1) and co-purify the PARP-1.DNA-PK.Ku80.Ku70.topoisomerase IIbeta-containing protein complex.
19144640 the specificity of DNA-PK action as a Ser-473 kinase for PKB in DNA repair signaling.
19092295 Observational study of gene-disease association. (HuGE Navigator)
19075392 Results identify the first human RS-SCID patient with a DNA-PKcs missense mutation, which also affects Artemis activation and function.
19074885 Observational study of gene-disease association. (HuGE Navigator)
19071136 results suggest that the late increase of ATM activity is needed to complement the decreasing ATR activity for maintaining a vigilant checkpoint regulation upon replication stress
19021771 DNA-PK-mediated signaling pathway is required for the increase in HIF-1alpha expression through activation of HSF1 and subsequent upregulation of heat shock proteins after hypoxic reconditioning.
18957425 Tax binds to and stabilizes a protein complex with DNA-PK and Chk2, resulting in a saturation of DNA-PK-mediated damage repair response
18952587 These findings suggest insulin-like growth factor-binding protein-2 plays a role in astrocytoma progression by promoting DNA-damage repair and therapeutic resistance.
18950845 Observational study of gene-disease association. (HuGE Navigator)
18922151 DNA-PK is a Tax-binding proteins and links multiple clusters in the DNA damage response network.
18799040 DNA-PKcs is positively expressed in the majority of nasopharyngeal carcinoma tissues.
18789131 Receptor, Epidermal Growth Factor blocked radiation-induced phosphorylation of DNA-PK and hampered repair of radiation-induced double strand breaks
18728186 The distribution of DNA-PK between nuclear and cytoplasmic compartments can thus potentially be influenced by relative inputs of cAMP signaling through the EPAC and PKA pathways.
18710952 DNA-PK(cs) does not appear to be essential, although the cell line lacking this gene has profound proliferation and genomic stability deficits not observed for other mammalian systems.
18644989 The effect of AKT1 on DNA-dependent protein kinase catalytic subunit (DNA-PKcs) activity and DNA-dsb repair in irradiated non-small cell lung cancer cell lines A549 and H460, was analysed.
18644470 The major phosphorylation sites in XLF, serine 245 is phosphorylated by DNA-PK, while serine 251 is phosphorylated by Ataxia-Telangiectasia Mutated (ATM), in vivo.
18550272 role of DNA-PKcs in the processing of complex DNA damage and its potential association with breast cancer development.
18508926 DNA damage left unrepaired by DNA-ligase IV or DNA-PK might be the initiator for caspase activation by doxorubicin in cancer cells
18505846 A signaling cascade for the regulation of p53 in response to ionizing radiation was proposed that involves activation of DNA-PK and Akt/PKB and inactivation of GSK-3 and Mdm2.
18451257 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18449888 Observational study of gene-disease association. (HuGE Navigator)
18426604 A suitable DNA-PKcs level in cells is necessary for maintaining genomic stability, while abnormal overexpression of DNA-PKcs may contribute to cell proliferation and even oncogenic transformation by stabilizing the c-Myc oncoprotein
18422577 The XRCC7 polymorphism appears to be involved in the etiology of human bladder cancer
18422577 Observational study of gene-disease association. (HuGE Navigator)
18415044 Pretreatment determination of DNA-PK/Ku86 activities might be helpful in identifying patients who will actually benefit from platinum-based treatment.
18270197 DNA-dependent protein kinase phosphorylation of the androgen receptor, or an interacting component, helps target the androgen receptor for export from the nucleus
18246802 Abnormal expression of GLUT-1, p63 and DNA-Pkcs may perhaps participate in serous ovarian tumor occurrence.
18172300 Taken together, these results show a DNA-PK-dependent component to the IR-induced G(2) checkpoint, in addition to the well-defined ATM-dependent component.
18158334 Histone mRNA stability may be directly controlled by ATR/ATM- and DNA-PK-mediated phosphorylation of UPF1.
17991316 The differences in the positive rate of DNA-PKcs were significant among normal ovarian tissues, benign, borderline, and malignant serous ovarian tumors.
17963495 DNA Ligase IV/XRCC4 recruitment by DNA-PK to DNA double-strand breaks prevents the formation of long ssDNA ends at double-strand breaks during the S phase.
17932067 There is some sequence-dependent variation in the efficiency and position of hairpin opening by Artemis:DNA-PKcs; providing more clarity on the extent to which the hairpin opening position contributes to junctional diversity in V(D)J recombination.
17786349 Lower DNA-PK activity correlated with higher chromosome instability and lymph node metastasis in breast cancer
17786318 Negative DNA-PKcs expression and frameshift mutation was associated with gastric cancer progression
17764108 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17626748 DNA-PKcs protein is highly expressed in cervical carcinoma, and its expression level could prognosticate the radiosensitivity of tumor cells.
17593081 No evidence was found that reduction in ATM protein levels in breast carcinoma is the result of epigenetic silencing. Cross-regulation between DNA-PKcs and ATM may be a possible cause in a subset of tumours.
17526517 Results confirm the importance of the ABCDE cluster as a DNA-PK autophosphorylation target.
17441731 The indispensable role played by DNA-PK in P-gp overexpression in MDR leukemia cells in this report identifies targeted DNA-PK inhibition as a rational strategy to reverse drug resistance in cancer.
17389609 Observational study of gene-disease association. (HuGE Navigator)
17287830 DNA-PK plays an essential role in repairing double-strand DNA breaks. Its catalytic subunit interacts with the Par3/Ku70/Ku80 complex in response to gamma-irradiation.
17242407 DNA-PK promotes the establishment of a repressive chromatin at a thyroid hormone receptor target promoter by enhancing the histone deacetylase activity of the receptor-bound nuclear receptor corepressor complex.
17241822 DNA-PK kinase activity results in disassembly of the Ku/DNA ligase IV/Xrcc4 complex
17196815 Observational study of gene-disease association. (HuGE Navigator)
17189255 ATM mediates DNA-PKcs phosphorylation at Thr-2609 as well as at the adjacent (S/T)Q motifs within the Thr-2609 cluster. DNA-PKcs- and ATM-mediated DNA-PKcs phosphorylations are cooperative and required for the full activation of DNA-PKcs
16874298 DNA-PK autophosphorylation regulates Artemis access to DNA ends, providing insight into the mechanism of Artemis mediated DNA end processing.
16857680 Ku-mediated assembly of DNA-PK on DNA ends is responsible for a dissociation of the DNA-PKcs.Artemis complex.
16785234 PKCepsilon activates Akt via DNA-PK to mediate its antiapoptotic function
16759233 DNA-PK mediates aggregative organization which enhances the DNA end-joining process
16751065 Cellular biotinylated protein kinase, DNA-activated, catalytic polypeptide (PRKDC) protein is incorporated into HIV-1 Gag virus-like particles
16713581 Dimeric particles are observed in which two DNA-PKcs/Ku70/Ku80 holoenzymes interact through the N-terminal HEAT repeats.
16600297 characterization of six DNA-PK phosphorylation sites on Artemis whose phosphorylation shows dependence on its association with DNA-PK catalytic subunit
16566590 DNA-PKcs & autophosphorylation-defective DNA-PKcs promote formation of large multi-DNA complexes in solution, suggesting multiple DNA-PK molecules may serve to bring multiple DNA ends into nonhomologous end joining complex.
16520097 The results demonstrate that activation of a UV-induced DNA damage response pathway, involving phosphorylation of RPA p34 by DNA-PK, is enhanced in cells lacking poleta.
16510122 Observational study of gene-disease association. (HuGE Navigator)
16314509 Blocking phosphorylation at the second major cluster of DNA-PK catalytic subunit autophosphorylation sites identified in this work enhances end processing and homologous recombination.
16075307 Cellular biotinylated protein kinase, DNA-activated, catalytic polypeptide (PRKDC) protein is incorporated into HIV-1 Gag virus-like particles
16046194 DNA-PK activity is required for the increased expression of H2AX in iradiated cells under hypertonic conditions.
16001975 caspase-dependent cleavage of DNA-PKcs during apoptosis does not contribute to the radiosensitizing effects of MG-132
16000400 Significantly lower DNA-PK activity is associated with uterine cervix and breast cancer
16000298 Data show that blockade of epidermal growth factor receptor import into the nucleus also blocks radiation-induced activation of DNA-PK, inhibits DNA repair, and increases radiosensitivity of treated cells.
15936993 Artemis:DNA-PKcs nuclease may be important in removing secondary structures that hinder processing of DNA ends during nonhomologous DNA end joining .
15875659 Cellular biotinylated protein kinase, DNA-activated, catalytic polypeptide (PRKDC) protein is incorporated into HIV-1 Gag virus-like particles
15758953 identification of related, conserved carboxy-terminal motifs in human Nbs1, ATRIP and Ku80 proteins that are required for their interaction with ATM, ATR and DNA-PKcs, respectively
15698568 Using cryo-electron microscopy there was generated an approximately 13 A three-dimensional map of DNA-PKcs, revealing the overall architecture and topology of the 4128 residue polypeptide chain and allowing location of domains
15677476 DNA-PKcs is preferentially activated by the physiologically relevant DNA replication-associated DSBs at the sites of DNA synthesis
15668400 Conserved splice variants of a catalytic subunit of DNA-PK (DNA-PKcs) are expressed predominately in nondividing cells
15668230 DNA-PK augments ATM and ATR in activation of Chk2 by DNA damage.
15520013 DNAPK was physically required for the mobilization of the XRCC4-ligase IV complex, and for stable recruitment of XRCC4; phosphorylation of either H2AX or XRCC4 was unnecessary for DNAPK or XRCC4-ligase IV recruitment
15493013 DNA-PK has a positive role in the regulation of apoptosis in human glioblastomas.
15389585 DNA-PK, ATM and possibly other kinases implicated in H2AX phosphorylation.
15381073 These results collectively suggested two pathways for IR-induced phosphorylation of Ser46, i.e., direct phosphorylation by DNA-PK and indirect phosphorylation via ATM.
15377652 DNA-PK autophosphorylation is regulated by MDC1 in response to DNA damage
15353130 reduced, not depleted expression of DNA-PK during the mature stages of myeloid differentiation
15313891 Observational study of gene-disease association. (HuGE Navigator)
15286704 Inhibition of PARP-1 and DNA-dependent protein kinase id a powerful strategy for tumor radiosensitization.
15279776 DNA-PK has roles in the cellular response to DNA double-strand breaks [review]
15262962 DNA-PK has a role in the Ser-473 phosphorylation step in the activation of PKB
15258142 Autophosphorylation at ABCDE sites thus apparently directs a rearrangement of the DNA-PK complex that ensures access to broken ends and joining steps are coupled together within a synaptic complex, making repair more accurate.
15163725 cleaved by picornain 2A during poliovirus infection of HeLa cells
15123719 Results show that Ku70/Ku80 and DNA-dependent protein kinase catalytic subunit (DNA-PKcs) modulate RAG-mediated cleavage during V(D)J recombination.
14966265 Data describe a novel pathway of ataxia telangiectasia mutated (ATM) and DNA-dependent protein kinase (DNA-PK) signaling that results in nuclear factor kappaB (NF-kappaB) activation and chemoresistance in response to DNA damage.
14766968 evidence that DNA-PK inhibits AAV integration both in vitro and in vivo
14734805 protein phosphatase 5 interacts with DNA-PKcs and dephosphorylates with surprising specificity at least two functional sites.
14704337 DNA-PK phosphorylated recombinant NDH II in the presence of RNA
14654699 working model in which DNA-PK creates a stable molecular bridge between two DNA ends that is remodeled after DNA-PK autophosphorylation
14627815 DNA-PK can be activated by nucleosomes through the ability of Ku to bind to the ends of nucleosomal DNA, and that the activated DNA-PK is capable of phosphorylating H2AX within the nucleosomes
14556663 up-regulation of DNA-PK complex protein, especially DNA-PKcs, after radiation treatment correlates to radiation resistance
12897153 Autophosphorylation of the catalytic subunit of the DNA-dependent protein kinase is required for efficient end processing during DNA double-strand break repair
12756247 Chk1 and DNA-PK complex proteins have a role in the repair of double strand breaks
12750264 Observational study of gene-disease association. (HuGE Navigator)
12672807 DNA-PKcs subunit and holoenzyme has a role in the signal transduction of ionizing radiation response
12547193 Coordinated assembly of Ku and p460 subunits of the DNA-dependent protein kinase on DNA ends is necessary for XRCC4-ligase IV recruitment
12379113 Autophosphorylation of DNA-PK plays an important regulatory role in DNA double-strand break repair by regulating the assembly and disassembly of the DNA-PK-DNA complex.
12231622 DNA-PKcs is autophosphorylated at Thr2609 in vivo in a Ku-dependent manner in response to ionizing radiation
12186630 phosphorylation at Thr2609, Ser2612, Thr2638 and Thr2647 may play an important role in DNA-PK function.
12065431 results suggest that DNA-PK(CS) brings DNA ends together and then undergoes activation of its kinase, presumably to regulate subsequent steps for processing and ligation of the ends
12065055 Roles of DNA-dependent protein kinase and ATM in cell-cycle-dependent radiation sensitivity in human cells.
11904432 DNA-dependent protein kinase suppresses double-strand break-induced and spontaneous homologous recombination
11867762 role for DNA-PK in regulating IRF-3 activity
11406603 Cellular biotinylated protein kinase, DNA-activated, catalytic polypeptide (PRKDC) protein is incorporated into HIV-1 Gag virus-like particles
11158303 Cellular biotinylated protein kinase, DNA-activated, catalytic polypeptide (PRKDC) protein is incorporated into HIV-1 Gag virus-like particles
11070027 Cellular biotinylated protein kinase, DNA-activated, catalytic polypeptide (PRKDC) protein is incorporated into HIV-1 Gag virus-like particles
10213687 Cellular biotinylated protein kinase, DNA-activated, catalytic polypeptide (PRKDC) protein is incorporated into HIV-1 Gag virus-like particles
9525578 Cellular biotinylated protein kinase, DNA-activated, catalytic polypeptide (PRKDC) protein is incorporated into HIV-1 Gag virus-like particles

AA Sequence

MAGSGAGVRCSLLRLQETLSAADRCGAALAGHQLIRGLGQECVLSSSPAVLALQTSLVFSRDFGLLVFVR      1 - 70
KSLNSIEFRECREEILKFLCIFLEKMGQKIAPYSVEIKNTCTSVYTKDRAAKCKIPALDLLIKLLQTFRS     71 - 140
SRLMDEFKIGELFSKFYGELALKKKIPDTVLEKVYELLGLLGEVHPSEMINNAENLFRAFLGELKTQMTS    141 - 210
AVREPKLPVLAGCLKGLSSLLCNFTKSMEEDPQTSREIFNFVLKAIRPQIDLKRYAVPSAGLRLFALHAS    211 - 280
QFSTCLLDNYVSLFEVLLKWCAHTNVELKKAALSALESFLKQVSNMVAKNAEMHKNKLQYFMEQFYGIIR    281 - 350
NVDSNNKELSIAIRGYGLFAGPCKVINAKDVDFMYVELIQRCKQMFLTQTDTGDDRVYQMPSFLQSVASV    351 - 420
LLYLDTVPEVYTPVLEHLVVMQIDSFPQYSPKMQLVCCRAIVKVFLALAAKGPVLRNCISTVVHQGLIRI    421 - 490
CSKPVVLPKGPESESEDHRASGEVRTGKWKVPTYKDYVDLFRHLLSSDQMMDSILADEAFFSVNSSSESL    491 - 560
NHLLYDEFVKSVLKIVEKLDLTLEIQTVGEQENGDEAPGVWMIPTSDPAANLHPAKPKDFSAFINLVEFC    561 - 630
REILPEKQAEFFEPWVYSFSYELILQSTRLPLISGFYKLLSITVRNAKKIKYFEGVSPKSLKHSPEDPEK    631 - 700
YSCFALFVKFGKEVAVKMKQYKDELLASCLTFLLSLPHNIIELDVRAYVPALQMAFKLGLSYTPLAEVGL    701 - 770
NALEEWSIYIDRHVMQPYYKDILPCLDGYLKTSALSDETKNNWEVSALSRAAQKGFNKVVLKHLKKTKNL    771 - 840
SSNEAISLEEIRIRVVQMLGSLGGQINKNLLTVTSSDEMMKSYVAWDREKRLSFAVPFREMKPVIFLDVF    841 - 910
LPRVTELALTASDRQTKVAACELLHSMVMFMLGKATQMPEGGQGAPPMYQLYKRTFPVLLRLACDVDQVT    911 - 980
RQLYEPLVMQLIHWFTNNKKFESQDTVALLEAILDGIVDPVDSTLRDFCGRCIREFLKWSIKQITPQQQE    981 - 1050
KSPVNTKSLFKRLYSLALHPNAFKRLGASLAFNNIYREFREEESLVEQFVFEALVIYMESLALAHADEKS   1051 - 1120
LGTIQQCCDAIDHLCRIIEKKHVSLNKAKKRRLPRGFPPSASLCLLDLVKWLLAHCGRPQTECRHKSIEL   1121 - 1190
FYKFVPLLPGNRSPNLWLKDVLKEEGVSFLINTFEGGGCGQPSGILAQPTLLYLRGPFSLQATLCWLDLL   1191 - 1260
LAALECYNTFIGERTVGALQVLGTEAQSSLLKAVAFFLESIAMHDIIAAEKCFGTGAAGNRTSPQEGERY   1261 - 1330
NYSKCTVVVRIMEFTTTLLNTSPEGWKLLKKDLCNTHLMRVLVQTLCEPASIGFNIGDVQVMAHLPDVCV   1331 - 1400
NLMKALKMSPYKDILETHLREKITAQSIEELCAVNLYGPDAQVDRSRLAAVVSACKQLHRAGLLHNILPS   1401 - 1470
QSTDLHHSVGTELLSLVYKGIAPGDERQCLPSLDLSCKQLASGLLELAFAFGGLCERLVSLLLNPAVLST   1471 - 1540
ASLGSSQGSVIHFSHGEYFYSLFSETINTELLKNLDLAVLELMQSSVDNTKMVSAVLNGMLDQSFRERAN   1541 - 1610
QKHQGLKLATTILQHWKKCDSWWAKDSPLETKMAVLALLAKILQIDSSVSFNTSHGSFPEVFTTYISLLA   1611 - 1680
DTKLDLHLKGQAVTLLPFFTSLTGGSLEELRRVLEQLIVAHFPMQSREFPPGTPRFNNYVDCMKKFLDAL   1681 - 1750
ELSQSPMLLELMTEVLCREQQHVMEELFQSSFRRIARRGSCVTQVGLLESVYEMFRKDDPRLSFTRQSFV   1751 - 1820
DRSLLTLLWHCSLDALREFFSTIVVDAIDVLKSRFTKLNESTFDTQITKKMGYYKILDVMYSRLPKDDVH   1821 - 1890
AKESKINQVFHGSCITEGNELTKTLIKLCYDAFTENMAGENQLLERRRLYHCAAYNCAISVICCVFNELK   1891 - 1960
FYQGFLFSEKPEKNLLIFENLIDLKRRYNFPVEVEVPMERKKKYIEIRKEAREAANGDSDGPSYMSSLSY   1961 - 2030
LADSTLSEEMSQFDFSTGVQSYSYSSQDPRPATGRFRRREQRDPTVHDDVLELEMDELNRHECMAPLTAL   2031 - 2100
VKHMHRSLGPPQGEEDSVPRDLPSWMKFLHGKLGNPIVPLNIRLFLAKLVINTEEVFRPYAKHWLSPLLQ   2101 - 2170
LAASENNGGEGIHYMVVEIVATILSWTGLATPTGVPKDEVLANRLLNFLMKHVFHPKRAVFRHNLEIIKT   2171 - 2240
LVECWKDCLSIPYRLIFEKFSGKDPNSKDNSVGIQLLGIVMANDLPPYDPQCGIQSSEYFQALVNNMSFV   2241 - 2310
RYKEVYAAAAEVLGLILRYVMERKNILEESLCELVAKQLKQHQNTMEDKFIVCLNKVTKSFPPLADRFMN   2311 - 2380
AVFFLLPKFHGVLKTLCLEVVLCRVEGMTELYFQLKSKDFVQVMRHRDDERQKVCLDIIYKMMPKLKPVE   2381 - 2450
LRELLNPVVEFVSHPSTTCREQMYNILMWIHDNYRDPESETDNDSQEIFKLAKDVLIQGLIDENPGLQLI   2451 - 2520
IRNFWSHETRLPSNTLDRLLALNSLYSPKIEVHFLSLATNFLLEMTSMSPDYPNPMFEHPLSECEFQEYT   2521 - 2590
IDSDWRFRSTVLTPMFVETQASQGTLQTRTQEGSLSARWPVAGQIRATQQQHDFTLTQTADGRSSFDWLT   2591 - 2660
GSSTDPLVDHTSPSSDSLLFAHKRSERLQRAPLKSVGPDFGKKRLGLPGDEVDNKVKGAAGRTDLLRLRR   2661 - 2730
RFMRDQEKLSLMYARKGVAEQKREKEIKSELKMKQDAQVVLYRSYRHGDLPDIQIKHSSLITPLQAVAQR   2731 - 2800
DPIIAKQLFSSLFSGILKEMDKFKTLSEKNNITQKLLQDFNRFLNTTFSFFPPFVSCIQDISCQHAALLS   2801 - 2870
LDPAAVSAGCLASLQQPVGIRLLEEALLRLLPAELPAKRVRGKARLPPDVLRWVELAKLYRSIGEYDVLR   2871 - 2940
GIFTSEIGTKQITQSALLAEARSDYSEAAKQYDEALNKQDWVDGEPTEAEKDFWELASLDCYNHLAEWKS   2941 - 3010
LEYCSTASIDSENPPDLNKIWSEPFYQETYLPYMIRSKLKLLLQGEADQSLLTFIDKAMHGELQKAILEL   3011 - 3080
HYSQELSLLYLLQDDVDRAKYYIQNGIQSFMQNYSSIDVLLHQSRLTKLQSVQALTEIQEFISFISKQGN   3081 - 3150
LSSQVPLKRLLNTWTNRYPDAKMDPMNIWDDIITNRCFFLSKIEEKLTPLPEDNSMNVDQDGDPSDRMEV   3151 - 3220
QEQEEDISSLIRSCKFSMKMKMIDSARKQNNFSLAMKLLKELHKESKTRDDWLVSWVQSYCRLSHCRSRS   3221 - 3290
QGCSEQVLTVLKTVSLLDENNVSSYLSKNILAFRDQNILLGTTYRIIANALSSEPACLAEIEEDKARRIL   3291 - 3360
ELSGSSSEDSEKVIAGLYQRAFQHLSEAVQAAEEEAQPPSWSCGPAAGVIDAYMTLADFCDQQLRKEEEN   3361 - 3430
ASVIDSAELQAYPALVVEKMLKALKLNSNEARLKFPRLLQIIERYPEETLSLMTKEISSVPCWQFISWIS   3431 - 3500
HMVALLDKDQAVAVQHSVEEITDNYPQAIVYPFIISSESYSFKDTSTGHKNKEFVARIKSKLDQGGVIQD   3501 - 3570
FINALDQLSNPELLFKDWSNDVRAELAKTPVNKKNIEKMYERMYAALGDPKAPGLGAFRRKFIQTFGKEF   3571 - 3640
DKHFGKGGSKLLRMKLSDFNDITNMLLLKMNKDSKPPGNLKECSPWMSDFKVEFLRNELEIPGQYDGRGK   3641 - 3710
PLPEYHVRIAGFDERVTVMASLRRPKRIIIRGHDEREHPFLVKGGEDLRQDQRVEQLFQVMNGILAQDSA   3711 - 3780
CSQRALQLRTYSVVPMTSRLGLIEWLENTVTLKDLLLNTMSQEEKAAYLSDPRAPPCEYKDWLTKMSGKH   3781 - 3850
DVGAYMLMYKGANRTETVTSFRKRESKVPADLLKRAFVRMSTSPEAFLALRSHFASSHALICISHWILGI   3851 - 3920
GDRHLNNFMVAMETGGVIGIDFGHAFGSATQFLPVPELMPFRLTRQFINLMLPMKETGLMYSIMVHALRA   3921 - 3990
FRSDPGLLTNTMDVFVKEPSFDWKNFEQKMLKKGGSWIQEINVAEKNWYPRQKICYAKRKLAGANPAVIT   3991 - 4060
CDELLLGHEKAPAFRDYVAVARGSKDHNIRAQEPESGLSEETQVKCLMDQATDPNILGRTWEGWEPWM     4061 - 4128
//

Text Mined References (370)

PMID Year Title
26992638 2016 Identification of PRKDC (Protein Kinase, DNA-Activated, Catalytic Polypeptide) as an essential gene for colorectal cancer (CRCs) cells.
26990988 2016 Two-Stage Synapsis of DNA Ends during Non-homologous End Joining.
26774662 2016 G(2)-M phase-correlative bystander effects are co-mediated by DNA-PKcs and ATM after carbon ion irradiation.
26772202 2016 RON Nuclear Translocation under Hypoxia Potentiates Chemoresistance to DNA Double-Strand Break-Inducing Anticancer Drugs.
26652902 2016 Differential Regulation of Progesterone Receptor-Mediated Transcription by CDK2 and DNA-PK.
26603896 2016 DNA-PKcs and PARP1 Bind to Unresected Stalled DNA Replication Forks Where They Recruit XRCC1 to Mediate Repair.
26578593 2016 DNA-PK triggers histone ubiquitination and signaling in response to DNA double-strand breaks produced during the repair of transcription-blocking topoisomerase I lesions.
26546606 2015 DNA-PKcs Is Involved in Ig Class Switch Recombination in Human B Cells.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26464705 2015 Blood-based DNA methylation of DNA repair genes in the non-homologous end-joining (NEHJ) pathway in patient with glioma.
26365377 2015 Distinct but Concerted Roles of ATR, DNA-PK, and Chk1 in Countering Replication Stress during S Phase.
26175416 2015 DNA-PKcs-Mediated Transcriptional Regulation Drives Prostate Cancer Progression and Metastasis.
26166223 Association of genetic polymorphisms in PRKDC and XRCC4 with risk of ESCC in a high-incidence region of North China.
26108997 2015 Targeting DNA-PKcs increased anticancer drug sensitivity by suppressing DNA damage repair in osteosarcoma cell line MG63.
26065416 2015 Proteomic Identification of DNA-PK Involvement within the RET Signaling Pathway.
26057167 2015 Activation of DNA Damage Response Pathways during Lytic Replication of KSHV.
26049366 2015 The involvement of c-Myc in the DNA double-strand break repair via regulating radiation-induced phosphorylation of ATM and DNA-PKcs activity.
26017556 2015 DNA-PKcs plays role in cancer metastasis through regulation of secreted proteins involved in migration and invasion.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25944161 2015 DNA double-strand break repair gene XRCC7 genotypes were associated with hepatocellular carcinoma risk in Taiwanese males and alcohol drinkers.
25941166 2015 XLS (c9orf142) is a new component of mammalian DNA double-stranded break repair.
25925375 2015 The Catalytic Subunit of DNA-Dependent Protein Kinase Coordinates with Polo-Like Kinase 1 to Facilitate Mitotic Entry.
25852083 2015 DNA-dependent protein kinase (DNA-PK) permits vascular smooth muscle cell proliferation through phosphorylation of the orphan nuclear receptor NOR1.
25842288 2015 PRKDC mutations associated with immunodeficiency, granuloma, and autoimmune regulator-dependent autoimmunity.
25823795 2015 Knockdown of microRNA-1323 restores sensitivity to radiation by suppression of PRKDC activity in radiation-resistant lung cancer cells.
25823028 2016 CD133 and DNA-PK regulate MDR1 via the PI3K- or Akt-NF-?B pathway in multidrug-resistant glioblastoma cells in vitro.
25815686 2015 DNA-dependent protein kinase catalytic subunit inhibitor reverses acquired radioresistance in lung adenocarcinoma by suppressing DNA repair.
25771720 2014 Suppression of DNA-dependent protein kinase sensitize cells to radiation without affecting DSB repair.
25756210 2015 Association Between Functional Polymorphisms of DNA Double-Strand Breaks in Repair Genes XRCC5, XRCC6 and XRCC7 with the Risk of Systemic Lupus Erythematosus in South East Iran.
25749521 2015 TNKS1BP1 functions in DNA double-strand break repair though facilitating DNA-PKcs autophosphorylation dependent on PARP-1.
25670504 2015 Interactome analysis identifies a new paralogue of XRCC4 in non-homologous end joining DNA repair pathway.
25574025 2015 DNA repair. PAXX, a paralog of XRCC4 and XLF, interacts with Ku to promote DNA double-strand break repair.
25550082 2015 The DNA-dependent protein kinase: A multifunctional protein kinase with roles in DNA double strand break repair and mitosis.
25503126 2014 Genotype of DNA double-strand break repair gene XRCC7 is associated with lung cancer risk in Taiwan males and smokers.
25495526 2014 Identification of synthetic lethality of PRKDC in MYC-dependent human cancers by pooled shRNA screening.
25480831 2015 DNA-PK-A candidate driver of hepatocarcinogenesis and tissue biomarker that predicts response to treatment and survival.
25348361 2015 DNA-PKcs deficiency sensitizes the human hepatoma HepG2 cells to cisplatin and 5-fluorouracil through suppression of the PI3K/Akt/NF-?B pathway.
25303530 2014 Enhancer activation requires trans-recruitment of a mega transcription factor complex.
25294801 2015 DNA-PKcs deficiency inhibits glioblastoma cell-derived angiogenesis after ionizing radiation.
25210793 2014 Activated platelets rescue apoptotic cells via paracrine activation of EGFR and DNA-dependent protein kinase.
25205036 2015 Targeting BRCA1-BER deficient breast cancer by ATM or DNA-PKcs blockade either alone or in combination with cisplatin for personalized therapy.
25078033 2014 TRIP13 promotes error-prone nonhomologous end joining and induces chemoresistance in head and neck cancer.
25046228 DNA-PKcs and Ku70 are predictive markers for poor prognosis of patients with gall bladder malignancies.
24979766 2014 RNF144A, an E3 ubiquitin ligase for DNA-PKcs, promotes apoptosis during DNA damage.
24844881 2014 Polo-like kinase 1 (PLK1) and protein phosphatase 6 (PP6) regulate DNA-dependent protein kinase catalytic subunit (DNA-PKcs) phosphorylation in mitosis.
24819595 2014 DNA-PK phosphorylation of RPA32 Ser4/Ser8 regulates replication stress checkpoint activation, fork restart, homologous recombination and mitotic catastrophe.
24680878 2014 DNA-PK: a dynamic enzyme in a versatile DSB repair pathway.
24662822 2015 DNA-PK/Chk2 induces centrosome amplification during prolonged replication stress.
24657168 2014 Inositol pyrophosphates mediate the DNA-PK/ATM-p53 cell death pathway by regulating CK2 phosphorylation of Tti1/Tel2.
24535266 2014 The rs7003908 (T>G) polymorphism in the XRCC7 gene and the risk of cancers.
24530422 2014 Phosphorylated Sp1 is the regulator of DNA-PKcs and DNA ligase IV transcription of daunorubicin-resistant leukemia cell lines.
24485452 2014 DNA damage triggers Golgi dispersal via DNA-PK and GOLPH3.
24429382 2014 Serines 440 and 467 in the Werner syndrome protein are phosphorylated by DNA-PK and affects its dynamics in response to DNA double strand breaks.
24365180 2013 DNA-dependent protein kinase catalytic subunit (DNA-PKcs)-SIN1 association mediates ultraviolet B (UVB)-induced Akt Ser-473 phosphorylation and skin cell survival.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24220101 2013 DNA-dependent protein kinase regulates DNA end resection in concert with Mre11-Rad50-Nbs1 (MRN) and ataxia telangiectasia-mutated (ATM).
24187467 2013 Abnormal DNA-PKcs and Ku 70/80 expression may promote malignant pathological processes in gastric carcinoma.
24166892 2014 DNA-PKcs associates with PLK1 and is involved in proper chromosome segregation and cytokinesis.
24136149 2013 Deregulation of DNA-dependent protein kinase catalytic subunit contributes to human hepatocarcinogenesis development and has a putative prognostic value.
24085291 2013 Inhibition of Snail1-DNA-PKcs protein-protein interface sensitizes cancer cells and inhibits tumor metastasis.
24013362 2013 DNA-PKcs inhibition sensitizes cancer cells to carbon-ion irradiation via telomere capping disruption.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23897887 2013 DNA structure-specific priming of ATR activation by DNA-PKcs.
23775790 2013 DNA damage-induced inhibition of rRNA synthesis by DNA-PK and PARP-1.
23722905 2013 PRKDC mutations in a SCID patient with profound neurological abnormalities.
23678292 2013 PIG3 functions in DNA damage response through regulating DNA-PKcs homeostasis.
23603433 2013 Instability at the FRA8I common fragile site disrupts the genomic integrity of the KIAA0146, CEBPD and PRKDC genes in colorectal cancer.
23505488 2013 Inactivation of DNA-dependent protein kinase promotes heat-induced apoptosis independently of heat-shock protein induction in human cancer cell lines.
23449453 2013 Mutual regulation between DNA-PKcs and Snail1 leads to increased genomic instability and aggressive tumor characteristics.
23392706 2013 Inhibition of DNA-dependent protein kinase catalytic subunit by small molecule inhibitor NU7026 sensitizes human leukemic K562 cells to benzene metabolite-induced apoptosis.
23325849 2013 An autonomous chromatin/DNA-PK mechanism for localized DNA damage signaling in mammalian cells.
23325550 2013 Identification of DNA-dependent protein kinase catalytic subunit as a novel interaction partner of lymphocyte enhancer factor 1.
23322783 2013 The N-terminal region of the DNA-dependent protein kinase catalytic subunit is required for its DNA double-stranded break-mediated activation.
23204796 2012 Association between exudative age-related macular degeneration and the G6721T polymorphism of XRCC7 in outdoor subjects.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184344 2013 Inhibition of DNA-dependent protein kinase reduced palmitate and oleate-induced lipid accumulation in HepG2 cells.
23183621 2012 The role of Ile3434Thr XRCC7 gene polymorphism in differentiated thyroid cancer risk in an Iranian population.
23178489 2014 The role of insulin-like growth factor binding protein-3 in the breast cancer cell response to DNA-damaging agents.
23149945 2013 Senataxin, defective in the neurodegenerative disorder ataxia with oculomotor apraxia 2, lies at the interface of transcription and the DNA damage response.
23108991 2013 Current evidence on the relationship between three polymorphisms in the XRCC7 gene and cancer risk.
23098854 2013 Inhibition of ERK activation enhances the repair of double-stranded breaks via non-homologous end joining by increasing DNA-PKcs activation.
23098447 2012 Association between XRCC5, 6 and 7 gene polymorphisms and the risk of breast cancer: a HuGE review and meta-analysis.
23001845 2012 ATF4 and IRE1? inhibit DNA repair protein DNA-dependent protein kinase 1 induced by heat shock.
22977523 2011 Functional interaction of BRCA1/ATM-associated BAAT1 with the DNA-PK catalytic subunit.
22923485 2012 Threonine 2609 phosphorylation of the DNA-dependent protein kinase is a critical prerequisite for epidermal growth factor receptor-mediated radiation resistance.
22825692 2012 Association between polymorphisms in DNA repair genes (XRCC1 and XRCC7) and risk of preeclampsia.
22815474 2012 Nuclear EGFR suppresses ribonuclease activity of polynucleotide phosphorylase through DNAPK-mediated phosphorylation at serine 776.
22753480 2012 Heat shock protein 90? (HSP90?), a substrate and chaperone of DNA-PK necessary for the apoptotic response.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22634101 2012 Genetic variation in DNA repair gene XRCC7 (G6721T) and susceptibility to breast cancer.
22529269 2012 Artemis C-terminal region facilitates V(D)J recombination through its interactions with DNA Ligase IV and DNA-PKcs.
22499342 2012 Recessive mutations in MCM4/PRKDC cause a novel syndrome involving a primary immunodeficiency and a disorder of DNA repair.
22343725 2012 DNAPKcs-dependent arrest of RNA polymerase II transcription in the presence of DNA breaks.
22332739 siRNA high-throughput kinase library screen identifies protein kinase, DNA-activated catalytic polypeptide to play a role in MyD88-induced IFNA2 activation and IL-8 secretion.
22310661 2012 Unmodified histone H3K4 and DNA-dependent protein kinase recruit autoimmune regulator to target genes.
22298787 2012 PP6 regulatory subunit R1 is bidentate anchor for targeting protein phosphatase-6 to DNA-dependent protein kinase.
22198295 2012 p53 and DNA-dependent protein kinase catalytic subunit independently function in regulating actin damage-induced tetraploid G1 arrest.
22190353 2011 DNA-PKCS binding to p53 on the p21WAF1/CIP1 promoter blocks transcription resulting in cell death.
22139836 2012 Sublethal doses of ?-amyloid peptide abrogate DNA-dependent protein kinase activity.
22131882 2011 DNA-PK mediates AKT activation and apoptosis inhibition in clinically acquired platinum resistance.
22040967 2011 [Expression of DNA-dependent protein kinase catalytic subunit in adult acute leukemia and its significance].
22027841 2011 Correct end use during end joining of multiple chromosomal double strand breaks is influenced by repair protein RAD50, DNA-dependent protein kinase DNA-PKcs, and transcription context.
22009179 2011 Inhibition of DNA-dependent protein kinase induces accelerated senescence in irradiated human cancer cells.
22002106 2012 Systematic analysis of protein pools, isoforms, and modifications affecting turnover and subcellular localization.
21979916 2011 Essential role for DNA-PK-mediated phosphorylation of NR4A nuclear orphan receptors in DNA double-strand break repair.
21941773 2011 [Roles of DNA dependent protein kinase in silica-induced cyclin E and CDK2 expressions and cell cycle changes in human embryo lung fibroblasts].
21905307 2011 Gene expression associated with DNA-dependent protein kinase activity under normoxia, hypoxia, and reoxygenation.
21775006 2011 Impact of PARP-1 and DNA-PK expression on survival in patients with glioblastoma multiforme.
21773671 2012 Rad51 and DNA-PKcs are involved in the generation of specific telomere aberrations induced by the quadruplex ligand 360A that impair mitotic cell progression and lead to cell death.
21750982 2011 Lack of the catalytic subunit of DNA-dependent protein kinase (DNA-PKcs) is accompanied by increased CK2?' levels.
21731742 2011 DNA-PK-dependent RPA2 hyperphosphorylation facilitates DNA repair and suppresses sister chromatid exchange.
21723633 2011 Function of erbB receptors and DNA-PKcs on phosphorylation of cytoplasmic and nuclear Akt at S473 induced by erbB1 ligand and ionizing radiation.
21679440 2011 Concordant and opposite roles of DNA-PK and the "facilitator of chromatin transcription" (FACT) in DNA repair, apoptosis and necrosis after cisplatin.
21671477 2012 Genetic variants in DNA repair genes and the risk of cutaneous malignant melanoma in melanoma-prone families with/without CDKN2A mutations.
21576354 2011 A DNA-dependent stress response involving DNA-PK occurs in hypoxic cells and contributes to cellular adaptation to hypoxia.
21575865 2011 Mechanistic rationale for inhibition of poly(ADP-ribose) polymerase in ETS gene fusion-positive prostate cancer.
21559021 2011 The association of DNA-dependent protein kinase activity of peripheral blood lymphocytes with prognosis of cancer.
21487018 2011 The DNA damage response kinases DNA-dependent protein kinase (DNA-PK) and ataxia telangiectasia mutated (ATM) Are stimulated by bulky adduct-containing DNA.
21450944 2011 DNA-dependent protein kinase interacts functionally with the RNA polymerase II complex recruited at the human immunodeficiency virus (HIV) long terminal repeat and plays an important role in HIV gene expression.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21330363 2011 Involvement of DNA-dependent protein kinase in normal cell cycle progression through mitosis.
21300785 2011 Inhibition of homologous recombination by DNA-dependent protein kinase requires kinase activity, is titratable, and is modulated by autophosphorylation.
21269460 2011 Initial characterization of the human central proteome.
21214942 2011 Strand-specific PCR of UV radiation-damaged genomic DNA revealed an essential role of DNA-PKcs in the transcription-coupled repair.
21188139 2010 The effect of DNA-dependent protein kinase on adeno-associated virus replication.
21175350 2011 Differential role of DNA-PKcs phosphorylations and kinase activity in radiosensitivity and chromosomal instability.
21108935 2011 Knockdown of the DNA-dependent protein kinase catalytic subunit radiosensitizes glioma-initiating cells by inducing autophagy.
21042724 2010 Low expression of Ku70/80, but high expression of DNA-PKcs, predict good response to radiotherapy in early breast cancer.
21037379 2010 Regulatory roles of tankyrase 1 at telomeres and in DNA repair: suppression of T-SCE and stabilization of DNA-PKcs.
20972425 2010 GAPDH mediates nitrosylation of nuclear proteins.
20966071 2010 Phosphorylation of p50 NF-kappaB at a single serine residue by DNA-dependent protein kinase is critical for VCAM-1 expression upon TNF treatment.
20878914 2010 DNA-dependent protein kinase catalytic subunit mediates T-cell loss in rheumatoid arthritis.
20813000 2010 Polymorphisms in DNA repair genes and risk of non-Hodgkin lymphoma in a pooled analysis of three studies.
20810650 2010 A genetic screen identifies the Triple T complex required for DNA damage signaling and ATM and ATR stability.
20801936 2010 Tel2 structure and function in the Hsp90-dependent maturation of mTOR and ATR complexes.
20711232 2010 Regulation of DNA-dependent protein kinase by protein kinase CK2 in human glioblastoma cells.
20610542 2010 Gamma-radiation sensitivity and polymorphisms in RAD51L1 modulate glioma risk.
20590474 2010 Polymorphic variants of DNA repair gene XRCC3 and XRCC7 and risk of prostate cancer: a study from North Indian population.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20427287 2010 Tti1 and Tel2 are critical factors in mammalian target of rapamycin complex assembly.
20383123 2010 Ku is a 5'-dRP/AP lyase that excises nucleotide damage near broken ends.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20219974 2010 Interaction of the double-strand break repair kinase DNA-PK and estrogen receptor-alpha.
20205745 2010 DNA-PKcs plays a dominant role in the regulation of H2AX phosphorylation in response to DNA damage and cell cycle progression.
20204287 2010 Radiosensitivity profiles from a panel of ovarian cancer cell lines exhibiting genetic alterations in p53 and disparate DNA-dependent protein kinase activities.
20157594 2009 SIRT6 stabilizes DNA-dependent protein kinase at chromatin for DNA double-strand break repair.
20111054 2010 Transcriptional activation of DNA-dependent protein kinase catalytic subunit gene expression by oestrogen receptor-alpha.
20085707 2010 Aire's partners in the molecular control of immunological tolerance.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20065038 2010 Protein phosphatase 6 interacts with the DNA-dependent protein kinase catalytic subunit and dephosphorylates gamma-H2AX.
20023628 2010 Crystal structure of DNA-PKcs reveals a large open-ring cradle comprised of HEAT repeats.
20003485 2009 DNA double strand break repair enzymes function at multiple steps in retroviral infection.
19946888 2010 Defining the membrane proteome of NK cells.
19851285 2009 Optimal function of the DNA repair enzyme TDP1 requires its phosphorylation by ATM and/or DNA-PK.
19833092 2009 Ku proteins function as corepressors to regulate farnesoid X receptor-mediated gene expression.
19815090 Do DNA repair genes OGG1, XRCC3 and XRCC7 have an impact on susceptibility to bladder cancer in the North Indian population?
19781633 2010 Suppression of DNA-PKcs enhances FGF-2 dependent human endothelial cell proliferation via negative regulation of Akt.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19697154 2010 BCR/ABL downregulates DNA-PK(CS)-dependent and upregulates backup non-homologous end joining in leukemic cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19672258 2009 Radioresistant cervical cancer shows upregulation of the NHEJ proteins DNA-PKcs, Ku70 and Ku86.
19624897 2009 [Correlation of DNA-dependent protein kinase catalytic subunit expression to radiosensitivity of non-small cell lung cancer cell lines].
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19589246 Significance of phosphatase and tensin homologue (PTEN), O(6)-methylguanine-DNA methyltransferase (MGMT), and DNA-dependent protein kinase catalytic subunit (DNA-PKcs) protein expression in gynaecomastia.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19467273 2009 Hepatitis C virus-core protein facilitates the degradation of Ku70 and reduces DNA-PK activity in hepatocytes.
19451221 2009 Translational reprogramming following UVB irradiation is mediated by DNA-PKcs and allows selective recruitment to the polysomes of mRNAs encoding DNA repair enzymes.
19444312 2009 Distinct roles of ATR and DNA-PKcs in triggering DNA damage responses in ATM-deficient cells.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19351595 2009 hnRNP-U is a specific DNA-dependent protein kinase substrate phosphorylated in response to DNA double-strand breaks.
19341095 Complexes of DNA-dependent protein kinase with single-stranded oligo-(AGGG)6: identification and possible role in modulation of ribosomal RNA transcription.
19303849 2009 A role of DNA-PK for the metabolic gene regulation in response to insulin.
19237606 2009 Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.
19224683 2009 [Role of DNA-dependent protein kinase catalytic subunit in silica-induced DNA double-strand break repair in human embryo lung fibroblasts].
19198648 2009 Activation of DNA-PK by ionizing radiation is mediated by protein phosphatase 6.
19181665 2009 Poly(ADP-ribose) Polymerase 1 Interacts with Nuclear Respiratory Factor 1 (NRF-1) and Plays a Role in NRF-1 Transcriptional Regulation.
19144640 2009 DNA-dependent protein kinase-mediated phosphorylation of protein kinase B requires a specific recognition sequence in the C-terminal hydrophobic motif.
19135898 2009 Purification of proteins associated with specific genomic Loci.
19092295 2008 RAD52 polymorphisms contribute to the development of papillary thyroid cancer susceptibility in Middle Eastern population.
19075392 2009 A DNA-PKcs mutation in a radiosensitive T-B- SCID patient inhibits Artemis activation and nonhomologous end-joining.
19074885 2008 Genetic variants in apoptosis and immunoregulation-related genes are associated with risk of chronic lymphocytic leukemia.
19071136 2009 DNA double-strand break formation upon UV-induced replication stress activates ATM and DNA-PKcs kinases.
19021771 2008 DNA-dependent protein kinase is involved in heat shock protein-mediated accumulation of hypoxia-inducible factor-1alpha in hypoxic preconditioned HepG2 cells.
18957425 2008 HTLV-1 Tax oncoprotein subverts the cellular DNA damage response via binding to DNA-dependent protein kinase.
18952587 2008 IGFBP2 is overexpressed by pediatric malignant astrocytomas and induces the repair enzyme DNA-PK.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18922151 2008 Physical and in silico approaches identify DNA-PK in a Tax DNA-damage response interactome.
18799040 2008 [Expression and clinical significance of DNA-PKcs in nasopharyngeal carcinoma].
18789131 2008 Radiation-induced caveolin-1 associated EGFR internalization is linked with nuclear EGFR transport and activation of DNA-PK.
18728186 2008 EPAC and PKA allow cAMP dual control over DNA-PK nuclear translocation.
18710952 2008 The catalytic subunit of DNA-dependent protein kinase regulates proliferation, telomere length, and genomic stability in human somatic cells.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18644989 2008 Targeting of AKT1 enhances radiation toxicity of human tumor cells by inhibiting DNA-PKcs-dependent DNA double-strand break repair.
18644470 2008 DNA-PK and ATM phosphorylation sites in XLF/Cernunnos are not required for repair of DNA double strand breaks.
18550272 2008 Processing of clustered DNA damage in human breast cancer cells MCF-7 with partial DNA-PKcs deficiency.
18508926 2008 DNA-ligase IV and DNA-protein kinase play a critical role in deficient caspases activation in apoptosis-resistant cancer cells by using doxorubicin.
18505846 2008 p53 stabilization in response to DNA damage requires Akt/PKB and DNA-PK.
18451257 2008 Tagging single nucleotide polymorphisms in phosphoinositide-3-kinase-related protein kinase genes involved in DNA damage "checkpoints" and lung cancer susceptibility.
18449888 2008 Variants in DNA double-strand break repair and DNA damage-response genes and susceptibility to lung and head and neck cancers.
18426604 2008 DNA-dependent protein kinase catalytic subunit modulates the stability of c-Myc oncoprotein.
18422577 2008 Genetic variants of the XRCC7 gene involved in DNA repair and risk of human bladder cancer.
18415044 2008 Activities of DNA-PK and Ku86, but not Ku70, may predict sensitivity to cisplatin in human gliomas.
18270197 2008 Activation of the DNA-dependent protein kinase stimulates nuclear export of the androgen receptor in vitro.
18246802 2007 [Expression of GLUT-1, p63 and DNA-Pkcs in serous ovarian tumors and their significance].
18172300 2008 DNA protein kinase-dependent G2 checkpoint revealed following knockdown of ataxia-telangiectasia mutated in human mammary epithelial cells.
18158334 2007 DNA-activated protein kinase functions in a newly observed S phase checkpoint that links histone mRNA abundance with DNA replication.
18026119 2007 A YY1-INO80 complex regulates genomic stability through homologous recombination-based repair.
17991316 2007 [Expression and significance of GLUT-1 and DNA-PKcs in serous ovarian tumors].
17963495 2007 Extensive ssDNA end formation at DNA double-strand breaks in non-homologous end-joining deficient cells during the S phase.
17932067 2007 Extent to which hairpin opening by the Artemis:DNA-PKcs complex can contribute to junctional diversity in V(D)J recombination.
17786349 2007 Association of DNA-PK activity and radiation-induced NBS1 foci formation in lymphocytes with clinical malignancy in breast cancer patients.
17786318 2007 Altered expression of DNA-dependent protein kinase catalytic subunit (DNA-PKcs) during gastric carcinogenesis and its clinical implications on gastric cancer.
17764108 2008 Polymorphisms in DNA repair genes, ionizing radiation exposure and risk of breast cancer in U.S. Radiologic technologists.
17626748 2007 [Potentials of DNA-PKcs, Ku80, and ATM in enhancing radiosensitivity of cervical carcinoma cells].
17593081 2007 The molecular causes of low ATM protein expression in breast carcinoma; promoter methylation and levels of the catalytic subunit of DNA-dependent protein kinase.
17526517 2007 Phosphorylation in the serine/threonine 2609-2647 cluster promotes but is not essential for DNA-dependent protein kinase-mediated nonhomologous end joining in human whole-cell extracts.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17441731 2007 Phosphorylation of RNA helicase A by DNA-dependent protein kinase is indispensable for expression of the MDR1 gene product P-glycoprotein in multidrug-resistant human leukemia cells.
17389609 2007 Tagging SNPs in non-homologous end-joining pathway genes and risk of glioma.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17308091 2007 A role for the HOXB7 homeodomain protein in DNA repair.
17287830 2007 Cell polarity protein Par3 complexes with DNA-PK via Ku70 and regulates DNA double-strand break repair.
17242407 2007 Phosphorylation of thyroid hormone receptor-associated nuclear receptor corepressor holocomplex by the DNA-dependent protein kinase enhances its histone deacetylase activity.
17241822 2007 Interaction of the Ku heterodimer with the DNA ligase IV/Xrcc4 complex and its regulation by DNA-PK.
17196815 2007 Polymorphisms of DNA repair genes are risk factors for prostate cancer.
17189255 2007 Ataxia telangiectasia mutated (ATM) is essential for DNA-PKcs phosphorylations at the Thr-2609 cluster upon DNA double strand break.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16874298 2006 DNA-PK autophosphorylation facilitates Artemis endonuclease activity.
16857680 2006 Interplay between Ku, Artemis, and the DNA-dependent protein kinase catalytic subunit at DNA ends.
16785234 2006 Protein kinase Cepsilon activates protein kinase B/Akt via DNA-PK to protect against tumor necrosis factor-alpha-induced cell death.
16759233 2006 Aggregative organization enhances the DNA end-joining process that is mediated by DNA-dependent protein kinase.
16713581 2006 Three-dimensional structure of the human DNA-PKcs/Ku70/Ku80 complex assembled on DNA and its implications for DNA DSB repair.
16600297 2006 Artemis phosphorylated by DNA-dependent protein kinase associates preferentially with discrete regions of chromatin.
16566590 2006 Analysis of DNA-dependent protein kinase-mediated DNA end joining by two-photon fluorescence cross-correlation spectroscopy.
16565220 2006 Phosphoproteome analysis of the human mitotic spindle.
16540648 2006 Phosphorylation of nucleotide excision repair factor xeroderma pigmentosum group A by ataxia telangiectasia mutated and Rad3-related-dependent checkpoint pathway promotes cell survival in response to UV irradiation.
16520097 2006 UV-induced RPA phosphorylation is increased in the absence of DNA polymerase eta and requires DNA-PK.
16510122 2006 Polymorphisms of DNA repair genes are associated with renal cell carcinoma.
16397295 2006 XRCC1 is phosphorylated by DNA-dependent protein kinase in response to DNA damage.
16314509 2005 Autophosphorylation of DNA-dependent protein kinase regulates DNA end processing and may also alter double-strand break repair pathway choice.
16046194 2005 DNA-PK is responsible for enhanced phosphorylation of histone H2AX under hypertonic conditions.
16001975 2005 The proteasome inhibitor MG-132 sensitizes PC-3 prostate cancer cells to ionizing radiation by a DNA-PK-independent mechanism.
16000400 2006 The association of DNA-dependent protein kinase activity with chromosomal instability and risk of cancer.
16000298 2005 Radiation-induced epidermal growth factor receptor nuclear import is linked to activation of DNA-dependent protein kinase.
15936993 2005 The Artemis:DNA-PKcs endonuclease cleaves DNA loops, flaps, and gaps.
15811628 2005 Artemis deficiency confers a DNA double-strand break repair defect and Artemis phosphorylation status is altered by DNA damage and cell cycle progression.
15758953 2005 Conserved modes of recruitment of ATM, ATR and DNA-PKcs to sites of DNA damage.
15723802 2005 Vigilins bind to promiscuously A-to-I-edited RNAs and are involved in the formation of heterochromatin.
15698568 2005 Three-dimensional structure and regulation of the DNA-dependent protein kinase catalytic subunit (DNA-PKcs).
15677476 2005 Cell cycle dependence of DNA-dependent protein kinase phosphorylation in response to DNA double strand breaks.
15668400 2005 Inhibition of homologous recombination by variants of the catalytic subunit of the DNA-dependent protein kinase (DNA-PKcs).
15668230 2005 Regulation of CHK2 by DNA-dependent protein kinase.
15640154 2005 Ku is a novel transcriptional recycling coactivator of the androgen receptor in prostate cancer cells.
15635413 2005 Nucleolar proteome dynamics.
15592499 2005 The life and death of DNA-PK.
15574326 2004 A biochemically defined system for mammalian nonhomologous DNA end joining.
15520013 2005 DNA-dependent protein kinase and XRCC4-DNA ligase IV mobilization in the cell in response to DNA double strand breaks.
15493013 2005 Glioblastoma cells deficient in DNA-dependent protein kinase are resistant to cell death.
15456891 2004 Artemis is a phosphorylation target of ATM and ATR and is involved in the G2/M DNA damage checkpoint response.
15389585 2005 Complex H2AX phosphorylation patterns by multiple kinases including ATM and DNA-PK in human cells exposed to ionizing radiation and treated with kinase inhibitors.
15381073 2004 Potentiality of DNA-dependent protein kinase to phosphorylate Ser46 of human p53.
15377652 2004 MDC1 regulates DNA-PK autophosphorylation in response to DNA damage.
15353130 2004 Expression of DNA-dependent protein kinase in human granulocytes.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15313891 2004 Polymorphisms of DNA repair genes and risk of glioma.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15286704 2004 Effects of novel inhibitors of poly(ADP-ribose) polymerase-1 and the DNA-dependent protein kinase on enzyme activities and DNA repair.
15279776 Role of DNA-PK in the cellular response to DNA double-strand breaks.
15262962 2004 Identification of a PKB/Akt hydrophobic motif Ser-473 kinase as DNA-dependent protein kinase.
15258142 2004 Non-homologous end joining requires that the DNA-PK complex undergo an autophosphorylation-dependent rearrangement at DNA ends.
15194694 2004 Phosphorylation and regulation of DNA ligase IV stability by DNA-dependent protein kinase.
15163725 2004 Proteolytic cleavage of the catalytic subunit of DNA-dependent protein kinase during poliovirus infection.
15123719 2004 Ku70/Ku80 and DNA-dependent protein kinase catalytic subunit modulate RAG-mediated cleavage: implications for the enforcement of the 12/23 rule.
15071507 2004 Functional and biochemical dissection of the structure-specific nuclease ARTEMIS.
14966265 2004 ATM and the catalytic subunit of DNA-dependent protein kinase activate NF-kappaB through a common MEK/extracellular signal-regulated kinase/p90(rsk) signaling pathway in response to distinct forms of DNA damage.
14766968 2004 DNA-dependent PK inhibits adeno-associated virus DNA integration.
14744996 2004 The metallo-beta-lactamase/beta-CASP domain of Artemis constitutes the catalytic core for V(D)J recombination.
14734805 2004 DNA-PKcs function regulated specifically by protein phosphatase 5.
14704337 2004 DNA-dependent protein kinase (DNA-PK) phosphorylates nuclear DNA helicase II/RNA helicase A and hnRNP proteins in an RNA-dependent manner.
14654699 2003 The role of DNA dependent protein kinase in synapsis of DNA ends.
14627815 2003 DNA-PK is activated by nucleosomes and phosphorylates H2AX within the nucleosomes in an acetylation-dependent manner.
14612514 2003 Down-regulation of histone H2B by DNA-dependent protein kinase in response to DNA damage through modulation of octamer transcription factor 1.
14556663 2003 Up-regulation of DNA-dependent protein kinase correlates with radiation resistance in oral squamous cell carcinoma.
12897153 2003 Autophosphorylation of the catalytic subunit of the DNA-dependent protein kinase is required for efficient end processing during DNA double-strand break repair.
12756247 2003 Regulatory interactions between the checkpoint kinase Chk1 and the proteins of the DNA-dependent protein kinase complex.
12750264 2003 Breast cancer risk associated with genotypic polymorphism of the nonhomologous end-joining genes: a multigenic study on cancer susceptibility.
12672807 2003 Novel localization of the DNA-PK complex in lipid rafts: a putative role in the signal transduction pathway of the ionizing radiation response.
12649176 2003 Threonines 2638/2647 in DNA-PK are essential for cellular resistance to ionizing radiation.
12547193 2003 Coordinated assembly of Ku and p460 subunits of the DNA-dependent protein kinase on DNA ends is necessary for XRCC4-ligase IV recruitment.
12519782 2003 Nuclear receptor coactivator thyroid hormone receptor-binding protein (TRBP) interacts with and stimulates its associated DNA-dependent protein kinase.
12509254 2002 Defining interactions between DNA-PK and ligase IV/XRCC4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12379113 2002 The DNA-dependent protein kinase interacts with DNA to form a protein-DNA complex that is disrupted by phosphorylation.
12231622 2002 Autophosphorylation of the DNA-dependent protein kinase catalytic subunit is required for rejoining of DNA double-strand breaks.
12186630 2002 Identification of in vitro and in vivo phosphorylation sites in the catalytic subunit of the DNA-dependent protein kinase.
12171929 2002 A proteomics approach to identify proliferating cell nuclear antigen (PCNA)-binding proteins in human cell lysates. Identification of the human CHL12/RFCs2-5 complex as a novel PCNA-binding protein.
12065431 2002 Synapsis of DNA ends by DNA-dependent protein kinase.
12065055 2002 Roles of DNA-dependent protein kinase and ATM in cell-cycle-dependent radiation sensitivity in human cells.
12023295 2002 Conversion of phosphoglycolate to phosphate termini on 3' overhangs of DNA double strand breaks by the human tyrosyl-DNA phosphodiesterase hTdp1.
11955432 2002 Hairpin opening and overhang processing by an Artemis/DNA-dependent protein kinase complex in nonhomologous end joining and V(D)J recombination.
11889123 2002 Werner protein is a target of DNA-dependent protein kinase in vivo and in vitro, and its catalytic activities are regulated by phosphorylation.
11883897 2002 Kinetic properties of p53 phosphorylation by the human vaccinia-related kinase 1.
11801738 2002 DNA damage-dependent interaction of the nuclear matrix protein C1D with Translin-associated factor X (TRAX).
11790298 2002 Directed proteomic analysis of the human nucleolus.
11749722 2001 Involvement of DNA-dependent protein kinase in regulation of stress-induced JNK activation.
11739746 2002 The RNA binding protein nuclear factor 90 functions as both a positive and negative regulator of gene expression in mammalian cells.
11731442 2001 Replication protein A2 phosphorylation after DNA damage by the coordinated action of ataxia telangiectasia-mutated and DNA-dependent protein kinase.
11709713 2001 UV-radiation induces dose-dependent regulation of p53 response and modulates p53-HDM2 interaction in human fibroblasts.
11551930 2001 Plk3 functionally links DNA damage to cell cycle arrest and apoptosis at least in part via the p53 pathway.
11418067 2001 Frameshift mutation in PRKDC, the gene for DNA-PKcs, in the DNA repair-defective, human, glioma-derived cell line M059J.
11406603 2001 Role of the non-homologous DNA end joining pathway in the early steps of retroviral infection.
11279128 2001 The binding of Ku antigen to homeodomain proteins promotes their phosphorylation by DNA-dependent protein kinase.
11160753 2001 EBNA-LP associates with cellular proteins including DNA-PK and HA95.
11158303 2001 Wortmannin potentiates integrase-mediated killing of lymphocytes and reduces the efficiency of stable transduction by retroviruses.
11101529 2000 Functional analysis of the human CDC5L complex and identification of its components by mass spectrometry.
11070027 2000 DNA-Dependent protein kinase is not required for efficient lentivirus integration.
11030616 2000 Binding of inositol phosphate to DNA-PK and stimulation of double-strand break repair.
10951572 2000 The human vaccinia-related kinase 1 (VRK1) phosphorylates threonine-18 within the mdm-2 binding site of the p53 tumour suppressor protein.
10823961 2000 Thyroid hormone receptor-binding protein, an LXXLL motif-containing protein, functions as a general coactivator.
10747897 2000 Stress-induced activation of protein kinase CK2 by direct interaction with p38 mitogen-activated protein kinase.
10673501 2000 The human homologs of checkpoint kinases Chk1 and Cds1 (Chk2) phosphorylate p53 at multiple DNA damage-inducible sites.
10567342 1999 Functional regulation of L-type calcium channels via protein kinase A-mediated phosphorylation of the beta(2) subunit.
10547363 1999 Differential subcellular localization of DNA-dependent protein kinase components Ku and DNA-PKcs during mitosis.
10470151 Phosphorylation by DNAPK inhibits the DNA-binding function of p53/T antigen complex in vitro.
10467406 1999 Suppression of the poly(ADP-ribose) polymerase activity by DNA-dependent protein kinase in vitro.
10464290 1999 Recruitment of ATM protein to double strand DNA irradiated with ionizing radiation.
10446239 1999 Mapping of protein-protein interactions within the DNA-dependent protein kinase complex.
10441130 1999 Identification of the sites phosphorylated by cyclic AMP-dependent protein kinase on the beta 2 subunit of L-type voltage-dependent calcium channels.
10213687 1999 A role for DNA-PK in retroviral DNA integration.
10207052 1999 The C terminus of Ku80 activates the DNA-dependent protein kinase catalytic subunit.
10064605 1999 Replication-mediated DNA damage by camptothecin induces phosphorylation of RPA by DNA-dependent protein kinase and dissociates RPA:DNA-PK complexes.
10026262 1999 DNA-dependent protein kinase phosphorylation sites in Ku 70/80 heterodimer.
9774685 1998 Inactivation of DNA-dependent protein kinase by protein kinase Cdelta: implications for apoptosis.
9766667 1998 Inhibition of phosphoinositide 3-kinase related kinases by the radiosensitizing agent wortmannin.
9765199 1998 The complexity of p53 modulation: emerging patterns from divergent signals.
9748231 1998 Regulation of DNA-dependent protein kinase by the Lyn tyrosine kinase.
9722660 1998 High mobility group proteins 1 and 2 can function as DNA-binding regulatory components for DNA-dependent protein kinase in vitro.
9679063 1998 DNA end-independent activation of DNA-PK mediated via association with the DNA-binding protein C1D.
9632806 1998 DNA-dependent protein kinase phosphorylation of IkappaB alpha and IkappaB beta regulates NF-kappaB DNA binding properties.
9586635 1998 Granzyme B directly and efficiently cleaves several downstream caspase substrates: implications for CTL-induced apoptosis.
9525578 1998 Modulation of Sp1 phosphorylation by human immunodeficiency virus type 1 Tat.
9442054 1998 DNA-dependent protein kinase interacts with antigen receptor response element binding proteins NF90 and NF45.
9435225 1998 DNA-dependent protein kinase: DNA binding and activation in the absence of Ku.
9430729 1998 The XRCC4 gene product is a target for and interacts with the DNA-dependent protein kinase.
9398855 1997 Genetic interaction between PARP and DNA-PK in V(D)J recombination and tumorigenesis.
9372844 1997 Interaction between DNA-dependent protein kinase and a novel protein, KIP.
9363941 1997 DNA damage-induced phosphorylation of p53 alleviates inhibition by MDM2.
9362500 1997 Double-strand break repair by Ku70 requires heterodimerization with Ku80 and DNA binding functions.
9325337 1997 Heat shock transcription factor 1 binds selectively in vitro to Ku protein and the catalytic subunit of the DNA-dependent protein kinase.
9312071 1997 Binding of Ku and c-Abl at the kinase homology region of DNA-dependent protein kinase catalytic subunit.
9295339 1997 Sites of UV-induced phosphorylation of the p34 subunit of replication protein A from HeLa cells.
9284934 1997 MCM4 and PRKDC, human genes encoding proteins MCM4 and DNA-PKcs, are close neighbours located on chromosome 8q12-->q13.
9139719 1997 Mapping of amino acid residues in the p34 subunit of human single-stranded DNA-binding protein phosphorylated by DNA-dependent protein kinase and Cdc2 kinase in vitro.
9038175 1997 Sequence-specific DNA binding and transcription factor phosphorylation by Ku Autoantigen/DNA-dependent protein kinase. Phosphorylation of Ser-527 of the rat glucocorticoid receptor.
9035691 1996 Purification and characterization of the double-stranded DNA-activated protein kinase, DNA-PK, from human placenta.
8917110 1996 Alternate splice-site utilization in the gene for the catalytic subunit of the DNA-activated protein kinase, DNA-PKcs.
8804412 1996 CPP32/Yama/apopain cleaves the catalytic component of DNA-dependent protein kinase in the holoenzyme.
8464713 1993 c-Jun is phosphorylated by the DNA-dependent protein kinase in vitro; definition of the minimal kinase recognition motif.
8422676 1993 The DNA-dependent protein kinase: requirement for DNA ends and association with Ku antigen.
8407951 1993 The carboxyl-terminal transactivation domain of human serum response factor contains DNA-activated protein kinase phosphorylation sites.
8364539 1993 Functional complementation in mouse-human radiation hybrids assigns the putative murine scid gene to the pericentric region of human chromosome 8.
7671312 1995 DNA-dependent protein kinase catalytic subunit: a relative of phosphatidylinositol 3-kinase and the ataxia telangiectasia gene product.
7638222 1995 Gene for the catalytic subunit of the human DNA-activated protein kinase maps to the site of the XRCC7 gene on chromosome 8.
7594449 1995 Human DNA-activated protein kinase (DNA-PK) is homologous to phosphatidylinositol kinases.
2507541 1989 The human double-stranded DNA-activated protein kinase phosphorylates the 90-kDa heat-shock protein, hsp90 alpha at two NH2-terminal threonine residues.
2247066 1990 A DNA-activated protein kinase from HeLa cell nuclei.
1597196 1992 DNA-activated protein kinase in Raji Burkitt's lymphoma cells. Phosphorylation of c-Myc oncoprotein.