Property Summary

Ligand Count 15
NCBI Gene PubMed Count 61
PubMed Score 23.40
PubTator Score 24.90

Knowledge Summary

Patent (10,073)

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma 1.100 1.8e-02
atypical teratoid / rhabdoid tumor 1.400 2.6e-06
ependymoma 1.600 5.1e-03
glioblastoma 1.200 1.5e-04
juvenile dermatomyositis -1.204 6.7e-11
Multiple myeloma 1.963 1.0e-03
non primary Sjogren syndrome sicca 1.100 1.4e-02
osteosarcoma -1.796 1.5e-04
ovarian cancer 1.300 1.9e-04
pancreatic ductal adenocarcinoma liver m... 1.427 3.9e-02
pediatric high grade glioma 1.100 1.6e-05
primitive neuroectodermal tumor 1.200 5.4e-03
sonic hedgehog group medulloblastoma 1.200 2.9e-05
spina bifida 1.251 3.6e-02
subependymal giant cell astrocytoma 1.161 2.0e-02

Gene RIF (42)

AA Sequence

MATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLLPAASELAHVK      1 - 70
QLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDLVEVVLSASATFEDFQIRPHA     71 - 140
LTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRCAFSIPNNCSGARKRRLSSTSLASGHSVRLG    141 - 210
TSESLPCTAEELSRSTTELLPRRPPSSSSSSSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQA    211 - 280
CKKLLKGLFRQGLQCKDCKFNCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSALMDESEDSGVI    281 - 350
PGSHSENALHASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWR    351 - 420
LDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPS    421 - 490
GQGAEAARGWETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIQENVDIATVYQIFPDEVLGSG    491 - 560
QFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVAILQSLRHPGIVNLECMFETPEKVFVVMEKL    561 - 630
HGDMLEMILSSEKGRLPERLTKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFAR    631 - 700
IIGEKSFRRSVVGTPAYLAPEVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPA    701 - 770
SPWSHISAGAIDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDVRWEQF    771 - 840
AAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL                                    841 - 878
//

Text Mined References (77)

PMID Year Title