Property Summary

Ligand Count 61
NCBI Gene PubMed Count 174
PubMed Score 775.19
PubTator Score 367.70

Knowledge Summary

Patent (36,268)

TINX Plot

  Disease (6)

Disease Target Count
Actinic keratosis 21
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 0.8
Liver cancer 604 0.0 0.6
lung cancer 4740 0.0 0.6
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 1.4
Type 2 diabetes mellitus 272 0.0 0.9

Expression

  Differential Expression (18)

Disease log2 FC p
aldosterone-producing adenoma -1.281 5.5e-03
astrocytoma 1.400 1.0e-22
Astrocytoma, Pilocytic 2.500 3.0e-10
Breast cancer -2.000 8.4e-17
breast carcinoma -1.100 1.0e-05
ependymoma 1.200 9.9e-06
glioblastoma 1.300 3.4e-05
group 4 medulloblastoma -1.900 9.1e-06
intraductal papillary-mucinous adenoma (... -2.300 6.1e-05
intraductal papillary-mucinous carcinoma... -2.200 2.9e-02
intraductal papillary-mucinous neoplasm ... -2.400 1.4e-03
lung adenocarcinoma -1.200 1.4e-12
malignant mesothelioma -2.700 4.8e-07
medulloblastoma, large-cell -2.000 4.0e-06
non-small cell lung cancer -1.120 6.9e-10
oligodendroglioma 1.200 3.1e-02
ovarian cancer -2.600 1.4e-09
pediatric high grade glioma 1.200 3.6e-04

Gene RIF (131)

AA Sequence

MSAPPVLRPPSPLLPVAAAAAAAAAALVPGSGPGPAPFLAPVAAPVGGISFHLQIGLSREPVLLLQDSSG      1 - 70
DYSLAHVREMACSIVDQKFPECGFYGMYDKILLFRHDPTSENILQLVKAASDIQEGDLIEVVLSASATFE     71 - 140
DFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGCGLNYHKRCAFKIPNNCSGVRRRRLSNVSLT    141 - 210
GVSTIRTSSAELSTSAPDEPLLQKSPSESFIGREKRSNSQSYIGRPIHLDKILMSKVKVPHTFVIHSYTR    211 - 280
PTVCQYCKKLLKGLFRQGLQCKDCRFNCHKRCAPKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDS    281 - 350
ERNSGLMDDMEEAMVQDAEMAMAECQNDSGEMQDPDPDHEDANRTISPSTSNNIPLMRVVQSVKHTKRKS    351 - 420
STVMKEGWMVHYTSKDTLRKRHYWRLDSKCITLFQNDTGSRYYKEIPLSEILSLEPVKTSALIPNGANPH    421 - 490
CFEITTANVVYYVGENVVNPSSPSPNNSVLTSGVGADVARMWEIAIQHALMPVIPKGSSVGTGTNLHRDI    491 - 560
SVSISVSNCQIQENVDISTVYQIFPDEVLGSGQFGIVYGGKHRKTGRDVAIKIIDKLRFPTKQESQLRNE    561 - 630
VAILQNLHHPGVVNLECMFETPERVFVVMEKLHGDMLEMILSSEKGRLPEHITKFLITQILVALRHLHFK    631 - 700
NIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVG    701 - 770
VIIYVSLSGTFPFNEDEDIHDQIQNAAFMYPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQ    771 - 840
DYQTWLDLRELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEETEMKALGERVS    841 - 910
IL                                                                        911 - 912
//

Text Mined References (186)

PMID Year Title