Property Summary

NCBI Gene PubMed Count 269
PubMed Score 112.88
PubTator Score 338.20

Knowledge Summary

Patent (8,563)

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 2.300 9.9e-06
astrocytoma -3.000 2.1e-03
posterior fossa group A ependymoma -3.800 1.1e-18
oligodendroglioma -2.100 1.8e-16
psoriasis 1.700 6.2e-05
glioblastoma -3.800 6.3e-07
osteosarcoma -1.604 1.3e-02
group 4 medulloblastoma -4.200 1.9e-08
atypical teratoid / rhabdoid tumor -3.000 9.8e-10
medulloblastoma, large-cell -4.100 1.2e-06
primitive neuroectodermal tumor -2.400 7.0e-08
non-small cell lung cancer -1.395 7.2e-19
pediatric high grade glioma -3.400 5.0e-09
pilocytic astrocytoma -2.200 1.5e-09
subependymal giant cell astrocytoma -3.698 4.5e-02
lung adenocarcinoma -1.100 1.4e-05
spina bifida -1.932 4.9e-02
ductal carcinoma in situ 1.400 7.4e-03
invasive ductal carcinoma 1.600 2.3e-02
ovarian cancer 1.700 3.8e-06
pituitary cancer -1.100 2.0e-05

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (187)

PMID Text
27143478 FRET-based translocation assays reveal that insulin promotes the association of both p62 and aPKC with the insulin-regulated scaffold IRS-1.
26887939 data suggest that the interaction between this novel region in Galphaq and the effector PKCzeta is a key event in Galphaq signaling.
26711256 The PKC-zeta - induced phosphorylation of GSK-3 beta stimulates GSK-3 beta activity.
26187466 Data show that aPKC scaffold protein p62 tethers Atypical protein kinase C (aPKC) in an active conformation.
25874946 Over-expression of PRKCZ results in gene and/or protein expression alterations of insulin-like growth factor 1 receptor (IGF1R) and integrin beta 3 (ITGB3) in SKOV3 and OVCAR3 cells.
25817572 PKCzeta inhibition prevented alternative cleavage and release of TROP2, suggesting that these events require endocytic uptake and exosomal release of the corresponding microvesicles.
25075435 PRKCZ methylation is associated with sunlight exposure
25070947 Neuronal NF1/RAS regulation of cyclic AMP requires atypical PKC zeta activation, which is perturbed in neurofibromatosis type 1.
24990612 PKCzeta and PKMzeta are overexpressed in TCF3-rearranged paediatric acute lymphoblastic leukaemia and may have a role in thiopurine sensitivity
24920238 Results indicate that PKCzeta regulates survivin expression levels and inhibits apoptosis in colon cancer cells.
24786829 The results indicate that induction and activation of PKCzeta promote TNBC growth, invasion and metastasis.
24753582 Report up-regulation of MT1-MMP and atypical protein kinase C in hormone receptor-negative breast tumors in association with a higher risk of metastasis. Silencing of aPKC impaired delivery of MT1-MMP from storage compartments and inhibited invasion.
24447338 These data indicate for the first time that HIV-1 Gag phosphorylation on Ser487 is mediated by atypical PKC and that this kinase may regulate the incorporation of Vpr into HIV-1 virions and thereby supports virus infectivity.
24447338 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
24015205 STAT3 is an important downstream mediator of the pro-carcinogenic effects of PRKCZ in pancreatic cancer cells.
23868949 the PKC family genes may play a role in the pathogenesis of MS relapse through modulating the association between 25(OH)D and relapse.
23374352 Study reports that PKCzeta-deficient cells reprogram their metabolism for the utilization of glutamine instead of glucose through the serine biosynthetic cascade controlled by 3-phosphoglycerate dehydrogenase (PHGDH).
23349801 Data indicate that the phosphorylation of GSK-3beta was reduced by siRNA of PKCdelta, PKCepsilon, and PKCzeta.
23266528 Results indicate the importance of p62-associated PKCzeta in the overactive state of pagetic osteoclasts (OCs) and in the activation of NF-kappaB, particularly in the presence of the p62(P392L) mutation.
23004934 The findings suggest a potential role for the use of PKCzeta levels in cord blood T cells as a presymptomatic test to predict allergy risk in children.
22812606 A proapoptotic role for protein kinase C zeta in the binding and phosphorylating Bcl10 at the nuclear envelope.
22791907 Stat3 forms a multiprotein complex with Rac1 and PKC in an hypoxia-reoxygenation-dependent manner.
22750245 these findings suggest that PKC-zeta is involved in the phosphorylation of HMGB1, and the phosphorylation of specific serine residues in the nuclear localization signal regions is related to enhanced HMGB1 secretion in colon cancer cells.
22740332 It was concluded that protein kinase C zeta regulated protein kinase phosphorylation, which in turn regulated the proteolytic activity of phorbol dibutyrate-induced podosomes by influencing the recruitment of protein kinase C zeta and MMP9 to podosomes.
22644296 A novel sequence was identified within the 3'-terminal domain of human PRKCZ.
22475757 SZ95 sebocytes express the conventional cPKCalpha; the novel nPKCdelta, epsilon, and eta; and the atypical aPKCzeta
22475628 Protein kinase C (PKC) zeta expression was significantly higher in normal than in cancerous tissues. Similarly, PKC zeta expression was down-regulated in four renal cancer cell lines compared to immortalized benign renal tubular cells.
22390153 Western Blot data showed decreased expression (p < 0,05) of Munc18c and phospho-PKC Zeta in polycystic ovary-insulin resistant endometria (PCOSE-IR) with respect to the control.
22324796 Report role of PKC-zeta induction in bronchial inflammation and airyway hyperresponsiveness.
22242160 HGF induced functional CXCR4 receptor expression in breast cancer cells. The effect of HGF was specifically mediated by PKCzeta activity.
22231931 Single nucleotide polymorphisms in protein kinase C zeta are associated with bipolar affective disorder.
22114277 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
21895402 High levels of protein kinase C zeta expression were associated with lymphatic metastasis in squamous cervical cancer.
21871968 The LNO(2) mediated signaling in lung type II epithelial cells occurs via a unique pathway involving PKCzeta.
21849550 Inhibition of protein kinase M zeta results in a reduction of synaptic PSD-95 accumulation in developing visual cortex
21780947 two key (hub) PPARgamma direct target genes, PRKCZ and PGK1, were experimentally validated to be repressed upon PPARgamma activation by its natural ligand, 15d-PGJ2 in three prostrate cancer cell lines
21667320 Changes in PKC iota, PKC zeta, and non-muscle MyoIIA expression are likely to participate in pathogenesis of epithelial barrier function in response to local pro-inflammatory signals.
21651489 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
21645497 human platelets express PKCzeta, and it may be constitutively phosphorylated at the activation loop threonine 410 and the turn motif threonine 560 under basal resting conditions, which are differentially dephosphorylated by outside-in signaling
21624955 The PKCzeta activation by d-flow induces endothelial cell (EC) apoptosis by regulating p53.
21619587 Results indicate that phosphorylation of human DNMT1 by protein kinase C is isoform-specific and provides the first evidence of cooperation between PKCzeta and DNMT1 in the control of the DNA methylation patterns of the genome.
21549621 Data indicate that both tumor focality and Par3/Par6/atypical protein kinase C (APKC) expression were significantly associated with tumor recurrence.
21454526 that upon DAMGO treatment, MOR activates PKCzeta through a PDK1-dependent signaling pathway to induce CCR5 phosphorylation and desensitization.
21390241 The prognostic impact of TGF-beta1, NF-kappaB p105, PKC-zeta, Par-6alpha, E-cadherin and vimentin in non-gastrointestinal stromal tumor soft tissue sarcomas, was investigated.
21081127 Results show that both PKC epsilon and PKC zeta isoforms are involved in the formation of ROS by C2-ceramide and the opening of the mPTP.
20949042 found that protein kinase C (PKC) zeta binds and phosphorylates LRRK2 both in vitro and in vivo
20941506 aPKC-zeta had moderate sensitivity as a marker of gastric dysplasia and additional studies are needed to establish its role in the diagnosis of dysplasia.
20844151 low levels of expression are associated with poorly differentiated tumours and a poor outcome in breast cancer patients
20679531 PKC zeta function in T helper cells is required for directional secretion of CD40 ligand (CD40L) and interferon (IFN)-gamma toward dendritic cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20538799 Results show that PKCzeta binds and phosphorylates ERK5, thereby decreasing eNOS protein stability and contributing to early events of atherosclerosis.
20501645 PKC zeta is differentially expressed in ovarian carcinomas and is phosphorylated in response to apoptotic stimuli in primary ovarian carcinoma cells.
20463008 These data identify atypical PKC isozymes as STAT and ERK activators that mediate c-fos and collagenase expression.
20417648 Inhibition of PKCzeta may be a novel drug target for thrombin-induced inflammatory hyperpermeability.
20416077 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20407013 Protein kinase C(PKC)zeta is a novel mitogenic downstream mediator of epidermal growth factor (EGF) receptor, and a therapeutic target as well, in some carcinomas.
20336759 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
20236512 RHOA and PRKCZ, and their downstream effectors, can represent important pharmacological targets that could potentially control the highly metastatic attitude of pancreatic ductal adenocarcinoma.
20236250 These results suggest that beta-catenin play an inhibitory role for dendrite formation through the modulation of PKCzeta and PKCdelta.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19812540 Patients who had an elevated anti-PKCzeta titer developed kidney allograft rejection, which was significantly more likely to result in graft loss.
19809379 Findings support the hypothesis that hepatocyte FIC1 enhances FXR signaling via a PKCzeta-dependent signaling pathway.
19751727 These results strongly suggest that DGKalpha positively regulates TNF-alpha-dependent NF-kappaB activation via the PKCzeta-mediated Ser311 phosphorylation of p65/RelA.
19502590 Data show that cholesteryl ester formation was dependent on protein kinase zeta/ extracellular signal-related kinase 1/2 (PKCzeta/ERK1/2) activation.
19460843 Serine proteases decrease intestinal epithelial ion permeability by activation of protein kinase Czeta.
19380829 Atypical protein kinase C isozyme PKCzeta associates functionally with small GTPase RhoA and acts as a signaling component downstream of RhoA.
19363595 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
19339512 Enhancement of calcium transport in Caco-2 monolayer through PKCzeta-dependent Cav1.3-mediated transcellular and rectifying paracellular pathways by prolactin.
19304661 There is a novel ceramide binding domain (C20zeta) in the carboxyl terminus of aPKC.
19201988 PKCzeta is required for CSF-1-induced chemotaxis of macrophages.
19187446 Protein kinase C zeta controls glioblastoma cell migration and invasion by regulating the cytoskeleton rearrangement.
19164129 crucial implication of PKC-delta, PKC-zeta, ERK-1/2, and p38 in human blood eosinophil migration through extracellular matrix components
19086264 the role of protein kinase C zeta (PKCzeta) in interleukin (IL)-8-mediated activation of Mac-1 (CD11b/CD18) in human neutrophils
19061073 These results indicate that insulin induces dynamic associations between PKCzeta, 80K-H, and munc18c and that 80K-H may act as a key signaling link between PKCzeta and munc18c in live cells.
19033536 PKC-zeta dependent stimulation of the human MCT1 promoter involves transcription factor AP2.
18989463 role for host PKCsigma (PKCzeta) on the invasion of hepatocytes by sporozoites
18760839 These results show a new function of HIV-1 Tat, its ability to regulate CXCR4 expression via PKCzeta.
18760839 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
18668687 FIC1 signals to FXR via PKC zeta. FIC1-related liver disease is likely related to downstream effects of FXR on bile acid homeostasis.
18615853 PRKCZ gene variants associated with the development of type 2 diabetes in this study needs to be investigated in a larger population to reveal any potential effects on metabolism.
18615853 Observational study of gene-disease association. (HuGE Navigator)
18577246 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
18571841 Atypical protein kinase C (PKC-iota/-zeta) phosphorylates IKKalphabeta in transformed non-malignant and malignant prostate cell survival.
18385757 PKCzeta is an important transduction molecule downstream of TNF-alpha signaling and is associated with increased expression of CD1d that may enhance CD1d-natural killer T cell interactions in psoriasis lesions.
18354190 modulation of PKC may have therapeutic potential in the prevention of smoke-related lung injury
18343365 Spisulosine inhibits the growth of the prostate tumor cells through intracellular ceramide accumulation and PKCzeta activation.
18321849 PKCzeta mediates LKB1-dependent Akt inhibition in response to peroxynitrite, resulting in endothelial apoptosis.
18319301 Data identify PKCzeta as regulators of EC lumenogenesis in 3D collagen matrices.
18313384 Results show that protein kinase C zeta phosphorylates and specifically stabilizes SRC-3 in a selective ER-dependent manner.
18296444 Protein kinase C-epsilon regulates sphingosine 1-phosphate-mediated migration of human lung endothelial cells through activation of phospholipase D2, protein kinase C-zeta, and Rac1
18166155 PKC zeta, but not PKCalpha, positively regulates Casp-2S mRNA assembly triggered by topoisomerase inhibitors
18094075 PKCzeta is the predominant isoform mediating stretch-induced COX-2 expression
18067888 Data suggest that foreign body giant cell formation is supported by PKCbeta, PKCdelta, and PKCzeta in combined diacylglycerol-dependent (PKCbeta and PKCdelta) and -independent (PKCzeta) signaling pathways.
18050214 PKCzeta is involved in regulation of IL-1beta-induced NF-kappaB signaling in human osteoarthritis chondrocytes, which regulates downstream expression of ADAMTS-4 and NOS2 via NF-kappaB.
17850925 In peripheral T-cells from severe cases of Alzheimer's patients, Abeta(1-42) treatment stimulates two distinct PKC-delta- and PKC-zeta-producing T-cell subpopulations which are not noticeable in healthy adult and elderly subjects.
17850789 These data suggest that PKCzeta activation plays a predominant role in regulation of PGE(2)-dependent melanocyte dendricity.
17786270 Hemoglobin promptly and markedly modified the levels of expression of both calcium-dependent PKCalpha and calcium-independent PKCzeta.
17682059 Data show that in renal cell carcinoma, the Cut-like homeodomain protein is involved in FIH-1 transcriptional regulation and is controlled by a specific signaling event involving protein kinase C zeta.
17544492 first study to show that allergic disease is associated with altered expression of T-cell PKC isozymes in the neonatal period
17541951 In osteoblasts of rheumatoid arthritis & osteoarthritis patients, PKC-zeta decreased when compared with normal cells. Treatment with IL-1beta & TNF-alpha significantly decreased PKC-zeta expression in post-traumatic osteoblasts.
17525161 PKCzeta may function as a physiological Bax kinase to directly phosphorylate and interact with Bax, which leads to sequestration of Bax in cytoplasm and abrogation of the proapoptotic function of Bax
17446166 insulin-stimulated IRS kinases such as PKCzeta overlap with IRS kinases triggered by inducers of insulin resistance, such as IKKbeta, to phosphorylate IRS-1 on common Ser si
17398070 MAP3K8 and PRKCZ cooperate in the regulation of the transcriptional activity of NFATC2 through the phosphorylation of its amino-terminal domain.
17389234 In tumor cells, protein kinase C (PKC) zeta was activated to phosphorylate RhoGDI-1, which liberated RhoGTPases, leading to their activation.
17369850 aPKCzeta cortical loading is associated with Lgl cytoplasmic release and tumor growth in Drosophila and human epithelia
17346701 We propose that increased water influx through AQP9 is critically involved in the formation of membrane protrusions, and that AQP9-induced actin polymerization is augmented by activation of Cdc42 and PKC(zeta).
17313651 activated form phosphorylates VAMP2 in vitro
17024099 the primary signaling pathway for LPC-dependent dendrite formation in human melanocytes involves the activation of PKCzeta and PKCzeta phosphorylation is Rac dependent
16943418 These studies have revealed a novel mechanism of Trichostatin A action through derecruitment of a repressor from the Luteinizing hormone receptor gene promoter in a PI3K/PKCzeta-induced Sp1 phosphorylation-dependent manner.
16940160 Studies indicate that PKC-zeta inhibits colon cancer cell growth and enhances differentiation and apoptosis, while inhibiting the transformed phenotype of these cells.
16931574 Protein kinase Czeta/mammalian target of rapamycin/S6 kinase pathway plays an important role for the transition of androgen-dependent to androgen-independent prostate cancer cells.
16798739 PKCzeta is a necessary component of the IL-1 and TNF signaling pathways in chondrocytes that result in catabolic destruction of extracellular matrix proteins in osteoarthritic cartilage
16644736 atypical PKCs are required for insulin-stimulated glucose transport in myocytes and adipocytes
16611744 Myosin II-B resides in a complex with p21-activated kinase 1 (PAK1) and atypical protein kinase C (PKC) zeta (aPKCzeta) and the interaction between these proteins is EGF-dependent.
16407220 PKC zeta-dependent AMP-activated protein kinase (AMPK) activation may play an important role in regulating not only cellular energy metabolism but also signaling pathways that control cell growth, differentiation, and survival.
16287866 phosphorylation and inhibition of caspase 9 by PKCzeta restrain the intrinsic apoptotic pathway during hyperosmotic stress
16011831 In this process p62-dependent Akt phosphorylation occurred via the release of Akt from PKCzeta by association of p62 and PKCzeta, which is known as a negative regulator of Akt activation.
15956717 described a novel bifurcated pathway by which relaxin stimulates Gs alpha and 1-Phosphatidylinositol 3-Kinase /PKCzeta leading to increased cyclic AMP production
15935276 data support the notion that PKCzeta is essential for LPS-induced NF-kB p65 subunit nuclear translocation in human myometrial cells
15887250 PKCZ mediates opposing effects on Na(+)-K(+)-Exchanging ATPase activity in a breast neoplasm cell line.
15870274 Ajuba is a new cytosolic component of the IL-1 signaling pathway modulating IL-1-induced NF-kappaB activation by influencing the assembly and activity of the aPKC/p62/TRAF6 multiprotein signaling complex
15808853 Results indicate that protein kinase C (PKC) zeta modulates hMutS alpha (MSH2, MSH6)stability and protein levels, and suggest a role for PKC zeta in genome stability by regulating mismatch repair activity.
15689238 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
15630457 stromal cell-derived factor 1 triggered PKC-zeta phosphorylation, translocation to the plasma membrane, and kinase activity
15604116 A role for PKCzeta in relaxin-mediated stimulation of cAMP was demonstrated.
15544481 Disruption of the cellular environment through genetic mutation, disease, injury, or exposure to pro-oxidants, alcohol, or other insults can induce pathological PKC activation.
15499829 We analyzed the dependence of the expression of some selected protein kinase C isoenzymes on the availability and/or action of androgens.
15362041 The differential regulation of protein kinase C-zeta by enteropathogenic E. coli and enterohemorrhagic E. coli may in part explain the less profound effect of the latter on the barrier function of tight junctions.
15358551 PKCzeta could act as a modulator of nucleotide excision repair activity by regulating the expression of XPC/hHR23B heterodimer
15313379 PKC-zeta, is critical to regulation of LPS-induced TLR4 lipid raft mobilization within macrophages.
15285019 Single nucleotide polymorphisms in protein kinase Cz (PKCZ) gene probably play a role in the susceptibility to type 2 diabetes by affecting the expression level of the relevant genes.
15254234 PKCzeta activity is regulated by nucleotide exchange factor ECT2
15210811 GTPase RhoA and atypical protein kinase Czeta are required for TLR2-mediated gene transcription.
15172966 involvement of PKC zeta in thrombin-induced permeability changes in human umbilical vein endothelial cells
15159477 There was expression of protein kinase C zeta in abnormal muscle fibers. Protein kinase C isoforms may play a role in the pathogenesis of myofibrillar myopathy.
15081397 identification of neuronal protein KIBRA as a novel substrate
15069075 phosphorylation of Ser(318) by PKC-zeta might contribute to the inhibitory effect of prolonged hyperinsulinemia on IRS-1 function.
14744756 PKCzeta is responsible for the activation of HIF-alpha by inhibiting the mRNA expression of FIH-1 thus promoting the transcription of hypoxia-inducible genes.
14570876 protein kinase C iota/lambda binds to Rab 2, which inhibits aPKCiota/lambda-dependent GADPH phosphorylation [Protein kinase C lambda]
12970910 PRKCZ gene may be associated with type 2 diabetes in Han population in North China. The haplotypes at five SNP sites in this gene may be responsible for this association.
12920244 disregulation of the function of atypical zeta PKC might be involved in the acquisition of an invasive and metastatic phenotype in pancreatic adenocarcinoma cells.
12905768 Observational study of gene-disease association. (HuGE Navigator)
12905622 Observational study of gene-disease association. (HuGE Navigator)
12900386 enteropathogenic E coli infection of intestinal epithelial cells activates several signaling pathways including PKC zeta and ERK that lead to NF-kappa B activation, thus ensuring the proinflammatory response.
12882907 Defective aPKC activation contributes to skeletal muscle insulin resistance in glucose intolerance and type 2 diabetes
12791393 PKCzeta has a role in regulating cell survival in tumor cells
12783114 The novel varepsilon and eta and atypical zeta, but not the conventional alpha and beta and the novel delta PKCs, may be involved in the signaling pathways involved in thrombin-induced human platelet P-selectin expression
12748064 PKC zeta has a role in the actin organization in ET-1-stimulated cells may play a role in myometrial contraction in pregnant women.
12671055 hypoxia decreases Na,K-ATPase activity in alveolar epithelial cells by triggering its endocytosis through mitochondrial reactive oxygen species and PKC-zeta-mediated phosphorylation of the Na,K-ATPase alpha(1) subunit
12493764 Protein kinase C zeta-GATA-2 signaling regulates VCAM1 stimulation by thrombin in endothelial cells
12482669 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
12435813 the role of PKCzeta in the negative regulation of drug-induced SM-CER pathway.
12244101 catalytic domain of PKC zeta is intrinsically inactive and dependent on the transphosphorylation of the activation lo
12242277 The adapter protein ZIP binds Grb14 and regulates its inhibitory action on insulin signaling by recruiting protein kinase Czeta.
12223351 EGF protects against oxidative disruption of the intestinal barrier by stabilizing the cytoskeleton in large part through the activation of PKC-zeta and downregulation of iNOS
12105221 shows for the first time that topoisomerase II beta is a substrate for PKC zeta, and that PKC zeta may significantly influence topoisomerase II inhibitor-induced cytotoxicity by altering topoisomerase II beta activity through its kinase function
12093536 REVIEW:Interaction of protein kinase C isozymes with membranes containing anionic phospholipids utilizing fluorescent phorbol esters to probe the properties of the C1 domains
12056906 PKC zeta expressed in human neutrophils can phosphorylate p47phox and induce both its translocation and NADPH oxidase activation as well as the binding of p47phox to the cytosolic fragment of p22phox.
12021260 role of PKCzeta in T cells through the control of NFAT function by modulating the activity of its transactivation domain
11960776 PKC-zeta is required in EGF protection of microtubules and intestinal barrier integrity against oxidant injury.
11919157 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
11833470 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
11765038 Investigation of the inhibitory effects of chelerythrine chloride on the translocation of the protein kinase C betaI, betaII, zeta in human neutrophils
11740573 Isoforms of protein kinase C and their distribution in human adrenal cortex and tumors
11504923 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
11154208 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
11141237 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
11044099 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
10843712 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
10641798 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
10491200 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
9671211 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
9446795 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
9151826 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
8914829 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
8627654 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
8599832 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
8473314 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
8206685 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
7876252 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
7850771 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
7642615 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
3259291 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
2182321 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
2139676 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
1970444 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages
1832084 The phosphorylation of HIV-1 Gag at Ser487 by PRKCZ regulates HIV-1 Vpr incorporation into virions and HIV-1 replication in macrophages

AA Sequence

MPSRTGPKMEGSGGRVRLKAHYGGDIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTV      1 - 70
SSQMELEEAFRLARQCRDEGLIIHVFPSTPEQPGLPCPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNR     71 - 140
RAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTCRKHMDSVMPSQEPPVDDKNEDADLPSEETD    141 - 210
GIAYISSSRKHDSIKDDSEDLKPVIDGMDGIKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAM    211 - 280
KVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPE    281 - 350
EHARFYAAEICIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAP    351 - 420
EILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLK    421 - 490
GFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDTQFTSEPVQLT    491 - 560
PDDEDAIKRIDQSEFEGFEYINPLLLSTEESV                                          561 - 592
//

Text Mined References (283)

PMID Year Title
27143478 2016 Protein Scaffolds Control Localized Protein Kinase C? Activity.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
27040869 2016 Novel PKC-? to p47 phox interaction is necessary for transformation from blebbishields.
26887939 2016 Protein Kinase C ? Interacts with a Novel Binding Region of G?q to Act as a Functional Effector.
26711256 2015 Glycogen Synthase Kinase 3? Is Positively Regulated by Protein Kinase C?-Mediated Phosphorylation Induced by Wnt Agonists.
26187466 2015 Zeta Inhibitory Peptide Disrupts Electrostatic Interactions That Maintain Atypical Protein Kinase C in Its Active Conformation on the Scaffold p62.
25874946 2015 Atypical protein kinase C zeta: potential player in cell survival and cell migration of ovarian cancer.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25817572 2015 Differential regulation of TROP2 release by PKC isoforms through vesicles and ADAM17.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25075435 2014 PRKCZ methylation is associated with sunlight exposure in a North American but not a Mediterranean population.
25070947 2014 Neuronal NF1/RAS regulation of cyclic AMP requires atypical PKC activation.
25011391 2014 Combining immunofluorescence with in situ proximity ligation assay: a novel imaging approach to monitor protein-protein interactions in relation to subcellular localization.
24990612 2015 PKC? and PKM? are overexpressed in TCF3-rearranged paediatric acute lymphoblastic leukaemia and are associated with increased thiopurine sensitivity.
24920238 2014 Protein kinase C ? regulates survivin expression and inhibits apoptosis in colon cancer.
24786829 2014 PKC?/? signaling promotes triple-negative breast cancer growth and metastasis.
24753582 2014 Control of MT1-MMP transport by atypical PKC during breast-cancer progression.
24447338 2014 The phosphorylation of HIV-1 Gag by atypical protein kinase C facilitates viral infectivity by promoting Vpr incorporation into virions.
24375676 2014 mTORC2 phosphorylates protein kinase C? to regulate its stability and activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24015205 2013 Protein kinase C zeta regulates human pancreatic cancer cell transformed growth and invasion through a STAT3-dependent mechanism.
23868949 2014 Novel modulating effects of PKC family genes on the relationship between serum vitamin D and relapse in multiple sclerosis.
23374352 2013 Control of nutrient stress-induced metabolic reprogramming by PKC? in tumorigenesis.
23349801 2013 Protein kinase C regulates human pluripotent stem cell self-renewal.
23266528 2013 Involvement of kinase PKC-zeta in the p62/p62(P392L)-driven activation of NF-?B in human osteoclasts.
23004934 2012 Neonatal protein kinase C zeta expression determines the neonatal T-Cell cytokine phenotype and predicts the development and severity of infant allergic disease.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22812606 2012 Role-shifting PKC? fosters its own proapoptotic destruction by complexing with Bcl10 at the nuclear envelope of human cervical carcinoma cells: a proteomic and biochemical study.
22791907 2012 Activation of Stat3 in endothelial cells following hypoxia-reoxygenation is mediated by Rac1 and protein Kinase C.
22750245 2012 High mobility group box-1 is phosphorylated by protein kinase C zeta and secreted in colon cancer cells.
22740332 2013 MEK/ERK pathway mediates PKC activation-induced recruitment of PKC? and MMP-9 to podosomes.
22644296 2012 Splice variant PRKC-?(-PrC) is a novel biomarker of human prostate cancer.
22475757 2012 Protein kinase C isoforms have differential roles in the regulation of human sebocyte biology.
22475628 2012 Down-regulation of PKC? in renal cell carcinoma and its clinicopathological implications.
22390153 2012 Protein expression of PKCZ (Protein Kinase C Zeta), Munc18c, and Syntaxin-4 in the insulin pathway in endometria of patients with polycystic ovary syndrome (PCOS).
22324796 2012 Bronchial inflammation induced PKC? over-expression: involvement in mechanical properties of airway smooth muscle.
22242160 2012 HGF-induced PKC? activation increases functional CXCR4 expression in human breast cancer cells.
22231931 2012 Tests of linkage and allelic association between markers in the 1p36 PRKCZ (protein kinase C zeta) gene region and bipolar affective disorder.
21895402 2011 Over-expression of protein kinase C?isoforms (?, ?, ? and ?) in squamous cervical cancer.
21871968 2011 Atypical PKC? transduces electrophilic fatty acid signaling in pulmonary epithelial cells.
21849550 2011 TrkB and protein kinase M? regulate synaptic localization of PSD-95 in developing cortex.
21780947 2011 PPAR? disease gene network and identification of therapeutic targets for prostate cancer.
21667320 2011 Aberrant expression of the polarity complex atypical PKC and non-muscle myosin IIA in active and inactive inflammatory bowel disease.
21645497 2011 Differential dephosphorylation of the protein kinase C-zeta (PKC?) in an integrin ?IIb?3-dependent manner in platelets.
21624955 2011 PKC? mediates disturbed flow-induced endothelial apoptosis via p53 SUMOylation.
21619587 2011 PKC isoforms interact with and phosphorylate DNMT1.
21549621 2013 Loss of APKC expression independently predicts tumor recurrence in superficial bladder cancers.
21454526 2011 Protein kinase Czeta mediates micro-opioid receptor-induced cross-desensitization of chemokine receptor CCR5.
21390241 2011 The prognostic impact of TGF-?1, fascin, NF-?B and PKC-? expression in soft tissue sarcomas.
21269460 2011 Initial characterization of the human central proteome.
21107309 2011 Genome-wide pharmacogenomic study of neurocognition as an indicator of antipsychotic treatment response in schizophrenia.
21081127 2011 Role of protein kinase C and mitochondrial permeability transition pore in the neuroprotective effect of ceramide in ischemia-induced cell death.
20949042 2010 Signal transduction protein array analysis links LRRK2 to Ste20 kinases and PKC zeta that modulate neuronal plasticity.
20941506 2010 Loss of cell polarity protein Lgl2 in foveolar-type gastric dysplasia: correlation with expression of the apical marker aPKC-zeta.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20844151 2010 PKCzeta regulates cell polarisation and proliferation restriction during mammary acinus formation.
20679531 2010 Activation of the ancestral polarity regulator protein kinase C zeta at the immunological synapse drives polarization of Th cell secretory machinery toward APCs.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20538799 2010 PKCzeta decreases eNOS protein stability via inhibitory phosphorylation of ERK5.
20501645 2010 Atypical protein kinase C zeta exhibits a proapoptotic function in ovarian cancer.
20463008 2010 Protein kinase C isoforms zeta and iota mediate collagenase expression and cartilage destruction via STAT3- and ERK-dependent c-fos induction.
20417648 2010 Role of protein kinase Czeta in thrombin-induced RhoA activation and inter-endothelial gap formation of human dermal microvessel endothelial cell monolayers.
20416077 2010 Identification of type 2 diabetes-associated combination of SNPs using support vector machine.
20407013 2010 Activation by tyrosine phosphorylation as a prerequisite for protein kinase C? to mediate epidermal growth factor receptor signaling to ERK.
20332120 2010 CCM1 regulates vascular-lumen organization by inducing endothelial polarity.
20236512 2010 RHOA and PRKCZ control different aspects of cell motility in pancreatic cancer metastatic clones.
20236250 2010 Beta-catenin regulates melanocyte dendricity through the modulation of PKCzeta and PKCdelta.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19812540 2009 Protein microarrays identify antibodies to protein kinase Czeta that are associated with a greater risk of allograft loss in pediatric renal transplant recipients.
19809379 2010 ATPase Class I Type 8B Member 1 and protein kinase C zeta induce the expression of the canalicular bile salt export pump in human hepatocytes.
19751727 2009 Diacylglycerol kinase alpha enhances protein kinase Czeta-dependent phosphorylation at Ser311 of p65/RelA subunit of nuclear factor-kappaB.
19502590 2009 Signaling through cholesterol esterification: a new pathway for the cholecystokinin 2 receptor involved in cell growth and invasion.
19460843 2009 Serine proteases decrease intestinal epithelial ion permeability by activation of protein kinase Czeta.
19380829 2009 An atypical protein kinase C (PKC zeta) plays a critical role in lipopolysaccharide-activated NF-kappa B in human peripheral blood monocytes and macrophages.
19339512 2009 Enhancement of calcium transport in Caco-2 monolayer through PKCzeta-dependent Cav1.3-mediated transcellular and rectifying paracellular pathways by prolactin.
19304661 2009 The carboxyl-terminal domain of atypical protein kinase Czeta binds to ceramide and regulates junction formation in epithelial cells.
19201988 2009 Pivotal Advance: PKCzeta is required for migration of macrophages.
19187446 2009 Reduction of protein kinase C zeta inhibits migration and invasion of human glioblastoma cells.
19164129 2009 Crucial implication of protein kinase C (PKC)-delta, PKC-zeta, ERK-1/2, and p38 MAPK in migration of human asthmatic eosinophils.
19086264 2008 The atypical zeta (zeta) isoform of protein kinase C regulates CD11b/CD18 activation in human neutrophils.
19061073 2008 80K-H acts as a signaling bridge in intact living cells between PKCzeta and the GLUT4 translocation regulator Munc18c.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19033536 2009 PKC-dependent stimulation of the human MCT1 promoter involves transcription factor AP2.
18989463 2008 Kinome-wide RNAi screen implicates at least 5 host hepatocyte kinases in Plasmodium sporozoite infection.
18760839 2008 HIV-1-Tat potentiates CXCL12/stromal cell-derived factor 1-induced downregulation of membrane CXCR4 in T lymphocytes through protein kinase C zeta.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18668687 2008 The membrane protein ATPase class I type 8B member 1 signals through protein kinase C zeta to activate the farnesoid X receptor.
18650932 2008 Par-4 inhibits Akt and suppresses Ras-induced lung tumorigenesis.
18615853 2008 Genetic variants in protein kinase C zeta gene and type 2 diabetes risk: a case-control study of a Chinese Han population.
18571841 2008 Atypical protein kinase C phosphorylates IKKalphabeta in transformed non-malignant and malignant prostate cell survival.
18385757 2008 Activation of keratinocyte protein kinase C zeta in psoriasis plaques.
18354190 2008 Protein kinase C alpha and zeta differentially regulate death-inducing signaling complex formation in cigarette smoke extract-induced apoptosis.
18343365 2008 Spisulosine (ES-285) induces prostate tumor PC-3 and LNCaP cell death by de novo synthesis of ceramide and PKCzeta activation.
18321849 2008 Protein kinase Czeta-dependent LKB1 serine 428 phosphorylation increases LKB1 nucleus export and apoptosis in endothelial cells.
18319301 2008 Cdc42- and Rac1-mediated endothelial lumen formation requires Pak2, Pak4 and Par3, and PKC-dependent signaling.
18313384 2008 Atypical protein kinase C regulates dual pathways for degradation of the oncogenic coactivator SRC-3/AIB1.
18296444 2008 Protein kinase C-epsilon regulates sphingosine 1-phosphate-mediated migration of human lung endothelial cells through activation of phospholipase D2, protein kinase C-zeta, and Rac1.
18190796 2008 KIBRA interacts with discoidin domain receptor 1 to modulate collagen-induced signalling.
18166155 2008 PKC zeta controls DNA topoisomerase-dependent human caspase-2 pre-mRNA splicing.
18094075 2008 Stretch induction of cyclooxygenase-2 expression in human urothelial cells is calcium- and protein kinase C zeta-dependent.
18067888 2008 Foreign body-type multinucleated giant cell formation requires protein kinase C beta, delta, and zeta.
18050214 2007 Involvement of protein kinase Czeta in interleukin-1beta induction of ADAMTS-4 and type 2 nitric oxide synthase via NF-kappaB signaling in primary human osteoarthritic chondrocytes.
17850925 2009 Abeta(1-42) stimulated T cells express P-PKC-delta and P-PKC-zeta in Alzheimer disease.
17850789 2007 Prostaglandin E2 regulates melanocyte dendrite formation through activation of PKCzeta.
17786270 2007 In vitro evidence of the role of hemoglobin during vasospasm on the modifications of the expression of PKCalpha and zeta.
17682059 2007 Protein kinase C-mediated modulation of FIH-1 expression by the homeodomain protein CDP/Cut/Cux.
17588663 2008 PKCtheta cooperates with atypical PKCzeta and PKCiota in NF-kappaB transactivation of T lymphocytes.
17544492 2007 Protein kinase Czeta: a novel protective neonatal T-cell marker that can be upregulated by allergy prevention strategies.
17541951 2008 PKC-zeta expression is lower in osteoblasts from arthritic patients: IL1-beta and TNF-alpha induce a similar decrease in non-arthritic human osteoblasts.
17525161 2007 Protein kinase Czeta abrogates the proapoptotic function of Bax through phosphorylation.
17446166 2007 Common inhibitory serine sites phosphorylated by IRS-1 kinases, triggered by insulin and inducers of insulin resistance.
17398070 2007 Cot/Tpl2 and PKCzeta cooperate in the regulation of the transcriptional activity of NFATc2 through the phosphorylation of its amino-terminal domain.
17389234 2007 Essential role of protein kinase C zeta in transducing a motility signal induced by superoxide and a chemotactic peptide, fMLP.
17369850 2007 aPKCzeta cortical loading is associated with Lgl cytoplasmic release and tumor growth in Drosophila and human epithelia.
17350623 2007 PKCzetaII is a target for degradation through the tumour suppressor protein pVHL.
17346701 2007 Filopodia are induced by aquaporin-9 expression.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17313651 2007 WD-repeat-propeller-FYVE protein, ProF, binds VAMP2 and protein kinase Czeta.
17203073 2007 aPKC-mediated phosphorylation regulates asymmetric membrane localization of the cell fate determinant Numb.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17057644 2006 A distinct PAR complex associates physically with VE-cadherin in vertebrate endothelial cells.
17024099 2007 Lysophosphatidylcholine mediates melanocyte dendricity through PKCzeta activation.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16943418 2006 Phosphatidylinositol 3-kinase/protein kinase Czeta-induced phosphorylation of Sp1 and p107 repressor release have a critical role in histone deacetylase inhibitor-mediated derepression [corrected] of transcription of the luteinizing hormone receptor gene.
16940160 2006 Protein Kinase-zeta inhibits collagen I-dependent and anchorage-independent growth and enhances apoptosis of human Caco-2 cells.
16931574 2006 Requirement of androgen-dependent activation of protein kinase Czeta for androgen-dependent cell proliferation in LNCaP Cells and its roles in transition to androgen-independent cells.
16903823 2006 Protein kinase Czeta and glucose uptake.
16798739 2006 Protein kinase Czeta is up-regulated in osteoarthritic cartilage and is required for activation of NF-kappaB by tumor necrosis factor and interleukin-1 in articular chondrocytes.
16792529 2006 A WD-FYVE protein binds to the kinases Akt and PKCzeta/lambda.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16644736 2006 Repletion of atypical protein kinase C following RNA interference-mediated depletion restores insulin-stimulated glucose transport.
16611744 2006 PAK1 and aPKCzeta regulate myosin II-B phosphorylation: a novel signaling pathway regulating filament assembly.
16407220 2006 Activation of protein kinase C zeta by peroxynitrite regulates LKB1-dependent AMP-activated protein kinase in cultured endothelial cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16322752 2006 PKCzeta at the crossroad of NF-kappaB and Jak1/Stat6 signaling pathways.
16287866 2005 Regulation of caspase 9 through phosphorylation by protein kinase C zeta in response to hyperosmotic stress.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16011831 2005 p62 modulates Akt activity via association with PKCzeta in neuronal survival and differentiation.
15956717 2005 Relaxin stimulates multiple signaling pathways: activation of cAMP, PI3K, and PKCzeta in THP-1 cells.
15935276 2005 A role for PKCzeta in the LPS-induced translocation NF-kappaB p65 subunit in cultured myometrial cells.
15894802 2005 Protein kinase C phosphorylation of the metabotropic glutamate receptor mGluR5 on Serine 839 regulates Ca2+ oscillations.
15887250 2005 Atypical PKC-zeta and PKC-iota mediate opposing effects on MCF-7 Na+/K+ATPase activity.
15870274 2005 The LIM protein Ajuba influences interleukin-1-induced NF-kappaB activation by affecting the assembly and activity of the protein kinase Czeta/p62/TRAF6 signaling complex.
15808853 2005 hMutS alpha is protected from ubiquitin-proteasome-dependent degradation by atypical protein kinase C zeta phosphorylation.
15721486 2005 Role of Ras/PKCzeta/MEK/ERK1/2 signaling pathway in angiotensin II-induced vascular smooth muscle cell proliferation.
15707389 2005 Identification of 80K-H as a protein involved in GLUT4 vesicle trafficking.
15630457 2005 Atypical PKC-zeta regulates SDF-1-mediated migration and development of human CD34+ progenitor cells.
15604116 2005 Relaxin stimulates protein kinase C zeta translocation: requirement for cyclic adenosine 3',5'-monophosphate production.
15544481 2004 Therapeutic potential of natural compounds that regulate the activity of protein kinase C.
15526032 2004 Crosstalk between PKCzeta and the IL4/Stat6 pathway during T-cell-mediated hepatitis.
15499829 2004 Effects of the antiandrogen flutamide on the expression of protein kinase C isoenzymes in LNCaP and PC3 human prostate cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15381704 2004 Protein kinase C isoforms differentially phosphorylate human choline acetyltransferase regulating its catalytic activity.
15362041 2004 Differing roles of protein kinase C-zeta in disruption of tight junction barrier by enteropathogenic and enterohemorrhagic Escherichia coli.
15358551 2004 Atypical protein kinase C stimulates nucleotide excision repair activity.
15324659 2004 aPKC acts upstream of PAR-1b in both the establishment and maintenance of mammalian epithelial polarity.
15314172 2004 Role of atypical protein kinase C in estradiol-triggered G1/S progression of MCF-7 cells.
15313379 2004 PKC-zeta is essential for endotoxin-induced macrophage activation.
15285019 2004 Effect of SNPs in protein kinase C zeta gene on gene expression in the reporter gene detection system.
15254234 2004 Nucleotide exchange factor ECT2 interacts with the polarity protein complex Par6/Par3/protein kinase Czeta (PKCzeta) and regulates PKCzeta activity.
15210811 2004 The low molecular weight GTPase RhoA and atypical protein kinase Czeta are required for TLR2-mediated gene transcription.
15172966 2004 Role of protein kinase Czeta in thrombin-induced endothelial permeability changes: inhibition by angiopoietin-1.
15159477 2004 Expression of protein kinase C isoforms and interleukin-1beta in myofibrillar myopathy.
15084291 2004 Atypical PKC phosphorylates PAR-1 kinases to regulate localization and activity.
15081397 2004 KIBRA is a novel substrate for protein kinase Czeta.
15069075 2004 Protein kinase C-zeta-induced phosphorylation of Ser318 in insulin receptor substrate-1 (IRS-1) attenuates the interaction with the insulin receptor and the tyrosine phosphorylation of IRS-1.
15003508 2004 Association of CPI-17 with protein kinase C and casein kinase I.
14744756 2004 Protein kinase C zeta transactivates hypoxia-inducible factor alpha by promoting its association with p300 in renal cancer.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699138 2004 Ki-1/57 interacts with RACK1 and is a substrate for the phosphorylation by phorbol 12-myristate 13-acetate-activated protein kinase C.
14697253 2004 Identification of a tissue-non-specific homologue of axonal fasciculation and elongation protein zeta-1.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
14654844 2003 Protein kinase C switches the Raf kinase inhibitor from Raf-1 to GRK-2.
14576165 2004 Phosphorylation of presenilin 1 at the caspase recognition site regulates its proteolytic processing and the progression of apoptosis.
14570876 2003 Rab2 interacts directly with atypical protein kinase C (aPKC) iota/lambda and inhibits aPKCiota/lambda-dependent glyceraldehyde-3-phosphate dehydrogenase phosphorylation.
14500673 2003 Eosinophil major basic protein stimulates neutrophil superoxide production by a class IA phosphoinositide 3-kinase and protein kinase C-zeta-dependent pathway.
12970910 2003 Protein kinase C/zeta (PRKCZ) gene is associated with type 2 diabetes in Han population of North China and analysis of its haplotypes.
12920244 2003 Motility analysis of pancreatic adenocarcinoma cells reveals a role for the atypical zeta isoform of protein kinase C in cancer cell movement.
12905768 2002 [Linkage disequilibrium analysis of the single nucleotide polymorphisms in the PRKCZ gene].
12905622 2002 [The association of two single nucleotide polymorphisms in PRKCZ and UTS2 respectively with type 2 diabetes in Han people of northern China].
12900386 2003 PKC zeta participates in activation of inflammatory response induced by enteropathogenic E. coli.
12893243 2003 Centaurin-alpha(1) associates with and is phosphorylated by isoforms of protein kinase C.
12887891 2003 PB1 domain-mediated heterodimerization in NADPH oxidase and signaling complexes of atypical protein kinase C with Par6 and p62.
12882907 2003 Activation of protein kinase C-zeta by insulin and phosphatidylinositol-3,4,5-(PO4)3 is defective in muscle in type 2 diabetes and impaired glucose tolerance: amelioration by rosiglitazone and exercise.
12881425 2003 Essential role of RelA Ser311 phosphorylation by zetaPKC in NF-kappaB transcriptional activation.
12791393 2003 Regulation of cell survival by atypical protein kinase C isozymes.
12783114 2003 Platelet P-selectin expression: requirement for protein kinase C, but not protein tyrosine kinase or phosphoinositide 3-kinase.
12774026 2003 Insulin receptor substrate-4 signaling in quiescent rat hepatocytes and in regenerating rat liver.
12761192 2003 Protein kinase Czeta (PKCzeta): activation mechanisms and cellular functions.
12748064 2003 A critical role for PKC zeta in endothelin-1-induced uterine contractions at the end of pregnancy.
12671055 2003 Hypoxia-induced endocytosis of Na,K-ATPase in alveolar epithelial cells is mediated by mitochondrial reactive oxygen species and PKC-zeta.
12551925 2003 Activation of Raf-1 signaling by protein kinase C through a mechanism involving Raf kinase inhibitory protein.
12493764 2003 Thrombin stimulation of vascular adhesion molecule-1 in endothelial cells is mediated by protein kinase C (PKC)-delta-NF-kappa B and PKC-zeta-GATA signaling pathways.
12482669 2002 Signaling pathways triggered by HIV-1 Tat in human monocytes to induce TNF-alpha.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12435813 2002 Overexpression of protein kinase Czeta confers protection against antileukemic drugs by inhibiting the redox-dependent sphingomyelinase activation.
12391145 2002 Sphingosine kinase mediates vascular endothelial growth factor-induced activation of ras and mitogen-activated protein kinases.
12244101 2002 Lack of constitutive activity of the free kinase domain of protein kinase C zeta. Dependence on transphosphorylation of the activation loop.
12242277 2002 The adapter protein ZIP binds Grb14 and regulates its inhibitory action on insulin signaling by recruiting protein kinase Czeta.
12234671 2002 Multiple splice variants of Par3 and of a novel related gene, Par3L, produce proteins with different binding properties.
12223351 2002 PKC-zeta prevents oxidant-induced iNOS upregulation and protects the microtubules and gut barrier integrity.
12162751 2002 Characterization of PDK2 activity against protein kinase B gamma.
12139760 2002 Protein kinase C-zeta overexpression induces erythroid phenotype in the monocytic leukaemia cell line U937.
12134071 2002 PC phosphorylation increases the ability of AFAP-110 to cross-link actin filaments.
12105221 2002 Overexpression of the atypical protein kinase C zeta reduces topoisomerase II catalytic activity, cleavable complexes formation, and drug-induced cytotoxicity in monocytic U937 leukemia cells.
12093536 2002 The use of fluorescent phorbol esters in studies of protein kinase C-membrane interactions.
12056906 2002 Phosphorylation of p47phox sites by PKC alpha, beta II, delta, and zeta: effect on binding to p22phox and on NADPH oxidase activation.
12021260 2002 Protein kinase Czeta phosphorylates nuclear factor of activated T cells and regulates its transactivating activity.
11937546 2002 Regulation of IL-1 receptor-associated kinases by lipopolysaccharide.
11919157 2002 HIV-1 Tat protein induces interleukin-10 in human peripheral blood monocytes: involvement of protein kinase C-betaII and -delta.
11833470 2001 [HIV-1 Tat protein induces IL-10 production by human monocytes: implications of the PKC and calcium pathway].
11788586 2002 Interaction of Bruton's tyrosine kinase and protein kinase Ctheta in platelets. Cross-talk between tyrosine and serine/threonine kinases.
11781095 2002 Regulation of both PDK1 and the phosphorylation of PKC-zeta and -delta by a C-terminal PRK2 fragment.
11765038 2001 Investigation of the inhibitory effects of chelerythrine chloride on the translocation of the protein kinase C betaI, betaII, zeta in human neutrophils.
11755531 2002 p62 forms a ternary complex with PKCzeta and PAR-4 and antagonizes PAR-4-induced PKCzeta inhibition.
11740573 2001 Isoforms of protein kinase C and their distribution in human adrenal cortex and tumors.
11739185 2001 Role of protein kinase C zeta isoform in Fas resistance of immature myeloid KG1a leukemic cells.
11684013 2001 Targeted disruption of the zetaPKC gene results in the impairment of the NF-kappaB pathway.
11585925 2001 Inhibition of protein kinase B (PKB) and PKCzeta mediates keratin K10-induced cell cycle arrest.
11535599 2001 The roles of phosphatidylinositol 3-kinase and protein kinase Czeta for thrombopoietin-induced mitogen-activated protein kinase activation in primary murine megakaryocytes.
11481324 2001 Insulin receptor substrate-2 phosphorylation is necessary for protein kinase C zeta activation by insulin in L6hIR cells.
11462174 2001 Park7, a novel locus for autosomal recessive early-onset parkinsonism, on chromosome 1p36.
11381116 2001 Phosphorylation sites of protein kinase C delta in H2O2-treated cells and its activation by tyrosine kinase in vitro.
11260256 2001 Human homologues of the Caenorhabditis elegans cell polarity protein PAR6 as an adaptor that links the small GTPases Rac and Cdc42 to atypical protein kinase C.
11222751 2001 Sp1 phosphorylation regulates inducible expression of platelet-derived growth factor B-chain gene via atypical protein kinase C-zeta.
11158308 2001 MEK5, a new target of the atypical protein kinase C isoforms in mitogenic signaling.
11154208 2001 HIV-1 Tat promotes monocyte chemoattractant protein-1 secretion followed by transmigration of monocytes.
11145703 2001 Protein kinase C zeta phosphorylates a subset of selective sites of the NADPH oxidase component p47phox and participates in formyl peptide-mediated neutrophil respiratory burst.
11063744 2001 Protein kinase C-zeta phosphorylates insulin receptor substrate-1 and impairs its ability to activate phosphatidylinositol 3-kinase in response to insulin.
11053446 2001 Sp1 phosphorylation regulates apoptosis via extracellular FasL-Fas engagement.
11044099 2000 Tat protein of human immunodeficiency virus type 1 induces interleukin-10 in human peripheral blood monocytes: implication of protein kinase C-dependent pathway.
11035106 2000 Protein kinase C zeta plays a central role in activation of the p42/44 mitogen-activated protein kinase by endotoxin in alveolar macrophages.
11016947 2000 Activation of atypical protein kinase C zeta by caspase processing and degradation by the ubiquitin-proteasome system.
10843712 2000 Release of calcium from inositol 1,4,5-trisphosphate receptor-regulated stores by HIV-1 Tat regulates TNF-alpha production in human macrophages.
10831594 2000 Protein kinase C [micro] is regulated by the multifunctional chaperon protein p32.
10779355 2000 IkappaB kinase alpha (IKKalpha) regulation of IKKbeta kinase activity.
10770953 2000 The bile acid taurochenodeoxycholate activates a phosphatidylinositol 3-kinase-dependent survival signaling cascade.
10770950 2000 Regulation of phospholipid scramblase activity during apoptosis and cell activation by protein kinase Cdelta.
10764742 2000 A 3-phosphoinositide-dependent protein kinase-1 (PDK1) docking site is required for the phosphorylation of protein kinase Czeta (PKCzeta ) and PKC-related kinase 2 by PDK1.
10764587 2000 PKC-zeta-associated CK2 participates in the turnover of free IkappaBalpha.
10747026 2000 The atypical PKC-interacting protein p62 channels NF-kappaB activation by the IL-1-TRAF6 pathway.
10733591 2000 Atypical protein kinases Clambda and -zeta associate with the GTP-binding protein Cdc42 and mediate stress fiber loss.
10636891 2000 Inhibition of the c-Jun N-terminal kinase/AP-1 and NF-kappaB pathways by PICOT, a novel protein kinase C-interacting protein with a thioredoxin homology domain.
10620507 2000 14-3-3 isotypes facilitate coupling of protein kinase C-zeta to Raf-1: negative regulation by 14-3-3 phosphorylation.
10617144 2000 Phosphorylation of HMG-I by protein kinase C attenuates its binding affinity to the promoter regions of protein kinase C gamma and neurogranin/RC3 genes.
10527887 1999 Identification of Src as a novel atypical protein kinase C-interacting protein.
10477520 1999 Differential stimulation of PKC phosphorylation of potassium channels by ZIP1 and ZIP2.
10383403 1999 Association of atypical protein kinase C isotypes with the docker protein FRS2 in fibroblast growth factor signaling.
10357815 1999 Serum and glucocorticoid-inducible kinase (SGK) is a target of the PI 3-kinase-stimulated signaling pathway.
10356400 1999 The interaction of p62 with RIP links the atypical PKCs to NF-kappaB activation.
10339425 1999 Rapamycin-sensitive phosphorylation of PKC on a carboxy-terminal site by an atypical PKC complex.
10195894 1999 Positive and negative regulation of IkappaB kinase activity through IKKbeta subunit phosphorylation.
10085094 1999 Protein kinase Czeta is a negative regulator of protein kinase B activity.
10022904 1999 Activation of IkappaB kinase beta by protein kinase C isoforms.
9971736 1999 Mammalian homologue of the Caenorhabditis elegans UNC-76 protein involved in axonal outgrowth is a protein kinase C zeta-interacting protein.
9768361 1998 Regulation of protein kinase C zeta by PI 3-kinase and PDK-1.
9756852 1998 Activation of Sp1-mediated vascular permeability factor/vascular endothelial growth factor transcription requires specific interaction with protein kinase C zeta.
9748166 1998 Protein kinase C isotypes controlled by phosphoinositide 3-kinase through the protein kinase PDK1.
9689078 1998 MEKK1 activates both IkappaB kinase alpha and IkappaB kinase beta.
9671211 1998 Human immunodeficiency virus Tat protein induces interleukin 6 mRNA expression in human brain endothelial cells via protein kinase C- and cAMP-dependent protein kinase pathways.
9566925 1998 Localization of atypical protein kinase C isoforms into lysosome-targeted endosomes through interaction with p62.
9512493 1998 Activation of protein kinase B beta and gamma isoforms by insulin in vivo and by 3-phosphoinositide-dependent protein kinase-1 in vitro: comparison with protein kinase B alpha.
9455484 1997 Characterization of cDNA clones in size-fractionated cDNA libraries from human brain.
9447975 1998 Activation of the mitogen-activated protein kinase/extracellular signal-regulated kinase pathway by conventional, novel, and atypical protein kinase C isotypes.
9446795 1998 Extracellular HIV-1 Tat protein induces a rapid and selective activation of protein kinase C (PKC)-alpha, and -epsilon and -zeta isoforms in PC12 cells.
9388266 1997 Nucleolin is a protein kinase C-zeta substrate. Connection between cell surface signaling and nucleus in PC12 cells.
9305920 1997 Identification of serine 643 of protein kinase C-delta as an important autophosphorylation site for its enzymatic activity.
8940095 1996 Protein-protein interaction of zinc finger LIM domains with protein kinase C.
8914829 1996 In vitro phosphorylation of human immunodeficiency virus type 1 Tat protein by protein kinase C: evidence for the phosphorylation of amino acid residue serine-46.
8856079 1996 Replacement of Ser657 of protein kinase C-alpha by alanine leads to premature down regulation after phorbol-ester-induced translocation to the membrane.
8797824 1996 The product of par-4, a gene induced during apoptosis, interacts selectively with the atypical isoforms of protein kinase C.
8627654 1996 Extracellular human immunodeficiency virus type 1 Tat protein is associated with an increase in both NF-kappa B binding and protein kinase C activity in primary human astrocytes.
8621384 1996 Activation of the epidermal growth factor receptor signal transduction pathway stimulates tyrosine phosphorylation of protein kinase C delta.
8375396 1993 Activation and substrate specificity of the human protein kinase C alpha and zeta isoenzymes.
8224878 1993 The cDNA sequence encoding human protein kinase C-zeta.
8206971 1994 Differential activation of adenylyl cyclase by protein kinase C isoenzymes.
8089108 1994 The phosphorylation of the respiratory burst oxidase component p47phox during neutrophil activation. Phosphorylation of sites recognized by protein kinase C and by proline-directed kinases.
7925449 1994 Bradykinin induces translocation of the protein kinase C isoforms alpha, epsilon, and zeta.
7597083 1995 Regulated assembly of tight junctions by protein kinase C.
7522330 1994 The pleckstrin homology domain of Bruton tyrosine kinase interacts with protein kinase C.
2182321 1990 Trans-activation of HIV-1 LTR-directed gene expression by tat requires protein kinase C.