Property Summary

Ligand Count 283
NCBI Gene PubMed Count 172
PubMed Score 10.78
PubTator Score 96.03

Knowledge Summary

Patent (4,999)

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -1.100 6.5e-03
cutaneous lupus erythematosus 2.900 4.9e-04
ependymoma -1.600 5.0e-03
group 3 medulloblastoma -2.800 9.3e-06
interstitial cystitis 1.200 9.9e-03
intraductal papillary-mucinous carcinoma... -1.300 4.2e-04
lung adenocarcinoma -1.110 1.7e-06
lung cancer 2.800 3.4e-03
lung carcinoma -2.300 2.5e-29
medulloblastoma, large-cell -1.600 9.8e-04
non-small cell lung cancer -1.788 4.1e-22
oligodendroglioma -1.300 6.3e-03
osteosarcoma -2.418 8.6e-04
ovarian cancer 1.400 1.5e-07
Pick disease -1.200 1.8e-03
primary Sjogren syndrome 1.100 9.1e-03
primitive neuroectodermal tumor -1.500 8.9e-03
psoriasis 1.200 2.0e-08
subependymal giant cell astrocytoma -1.403 2.5e-02

Protein-protein Interaction (2)

Gene RIF (141)

AA Sequence

MSPFLRIGLSNFDCGSCQSCQGEAVNPYCAVLVKEYVESENGQMYIQKKPTMYPPWDSTFDAHINKGRVM      1 - 70
QIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNARYFLEMSDTKDMNEFETEGFF     71 - 140
ALHQRRGAIKQAKVHHVKCHEFTATFFPQPTFCSVCHEFVWGLNKQGYQCRQCNAAIHKKCIDKVIAKCT    141 - 210
GSAINSRETMFHKERFKIDMPHRFKVYNYKSPTFCEHCGTLLWGLARQGLKCDACGMNVHHRCQTKVANL    211 - 280
CGINQKLMAEALAMIESTQQARCLRDTEQIFREGPVEIGLPCSIKNEARPPCLPTPGKREPQGISWESPL    281 - 350
DEVDKMCHLPEPELNKERPSLQIKLKIEDFILHKMLGKGSFGKVFLAEFKKTNQFFAIKALKKDVVLMDD    351 - 420
DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAAEIIL    421 - 490
GLQFLHSKGIVYRDLKLDNILLDKDGHIKIADFGMCKENMLGDAKTNTFCGTPDYIAPEILLGQKYNHSV    491 - 560
DWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPRWLEKEAKDLLVKLFVREPEKRLGVRGDIRQ    561 - 630
HPLFREINWEELERKEIDPPFRPKVKSPFDCSNFDKEFLNEKPRLSFADRALINSMDQNMFRNFSFMNPG    631 - 700
MERLIS                                                                    701 - 706
//

Text Mined References (192)

PMID Year Title