Property Summary

Ligand Count 99
NCBI Gene PubMed Count 92
PubMed Score 65.36
PubTator Score 61.03

Knowledge Summary

Patent (5,659)

Expression

  Differential Expression (12)

Disease log2 FC p
esophageal adenocarcinoma -1.400 4.4e-02
intraductal papillary-mucinous carcinoma... -1.600 1.2e-02
lung adenocarcinoma -1.500 9.7e-17
lung cancer -3.400 4.6e-05
lung carcinoma -1.700 2.4e-25
malignant mesothelioma -3.100 1.2e-07
medulloblastoma, large-cell -1.100 4.4e-04
nephrosclerosis 1.052 4.3e-04
osteosarcoma -1.440 5.9e-03
pituitary cancer -2.000 9.6e-08
psoriasis 1.400 6.9e-04
ulcerative colitis 1.200 1.6e-04

Gene RIF (91)

AA Sequence

MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTKQKTNKPTYNE      1 - 70
EFCANVTDGGHLELAVFHETPLGYDHFVANCTLQFQELLRTTGASDTFEGWVDLEPEGKVFVVITLTGSF     71 - 140
TEATLQRDRIFKHFTRKRQRAMRRRVHQINGHKFMATYLRQPTYCSHCREFIWGVFGKQGYQCQVCTCVV    141 - 210
HKRCHHLIVTACTCQNNINKVDSKIAEQRFGINIPHKFSIHNYKVPTFCDHCGSLLWGIMRQGLQCKICK    211 - 280
MNVHIRCQANVAPNCGVNAVELAKTLAGMGLQPGNISPTSKLVSRSTLRRQGKESSKEGNGIGVNSSNRL    281 - 350
GIDNFEFIRVLGKGSFGKVMLARVKETGDLYAVKVLKKDVILQDDDVECTMTEKRILSLARNHPFLTQLF    351 - 420
CCFQTPDRLFFVMEFVNGGDLMFHIQKSRRFDEARARFYAAEIISALMFLHDKGIIYRDLKLDNVLLDHE    421 - 490
GHCKLADFGMCKEGICNGVTTATFCGTPDYIAPEILQEMLYGPAVDWWAMGVLLYEMLCGHAPFEAENED    491 - 560
DLFEAILNDEVVYPTWLHEDATGILKSFMTKNPTMRLGSLTQGGEHAILRHPFFKEIDWAQLNHRQIEPP    561 - 630
FRPRIKSREDVSNFDPDFIKEEPVLTPIDEGHLPMINQDEFRNFSYVSPELQP                     631 - 683
//

Text Mined References (102)

PMID Year Title