Property Summary

Ligand Count 186
NCBI Gene PubMed Count 557
PubMed Score 141.43
PubTator Score 1972.93

Knowledge Summary

Patent (7,423)

TINX Plot

  Disease (7)

Disease Target Count
Actinic keratosis 21
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0

Expression

  Differential Expression (10)

Disease log2 FC p
acute myeloid leukemia 2.300 4.1e-02
atypical teratoid/rhabdoid tumor -1.200 2.5e-05
ependymoma -1.100 6.4e-03
group 3 medulloblastoma -1.400 9.4e-03
interstitial cystitis -1.200 1.8e-03
lung cancer -1.100 3.4e-02
lung carcinoma -1.300 1.1e-20
medulloblastoma, large-cell -1.200 7.7e-03
oligodendroglioma -1.300 1.3e-03
osteosarcoma -2.070 4.0e-04

Gene RIF (427)

AA Sequence

MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFDAHIYEGRVIQ      1 - 70
IVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQYFLEDVDCKQSMRSEDEAKFP     71 - 140
TMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTG    141 - 210
TAANSRDTIFQKERFNIDMPHRFKVHNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLC    211 - 280
GINQKLLAEALNQVTQRASRRSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFI    281 - 350
FHKVLGKGSFGKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTK    351 - 420
DHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVLLDRDGHIKIA    421 - 490
DFGMCKENIFGESRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYEMLIGQSPFHGDDEDELFESI    491 - 560
RVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDY    561 - 630
SNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED                            631 - 676
//

Text Mined References (579)

PMID Year Title