Property Summary

Ligand Count 218
NCBI Gene PubMed Count 317
PubMed Score 93.48
PubTator Score 383.81

Knowledge Summary

Patent (10,807)


  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.7
Liver cancer 604 0.0 0.5
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 3.0
Rheumatoid arthritis 1191 0.0 1.1
Disease Target Count Z-score Confidence
Amphetamine abuse 2 3.254 1.6


  Differential Expression (33)

Disease log2 FC p
lung cancer -1.800 2.0e-03
active ulcerative colitis -1.209 4.6e-03
adult high grade glioma -4.200 5.5e-05
astrocytic glioma -2.900 4.1e-03
Astrocytoma, Pilocytic -2.700 2.5e-06
Atopic dermatitis -1.400 3.1e-03
atypical teratoid / rhabdoid tumor -6.400 3.8e-12
colon cancer -2.500 1.5e-04
Down syndrome -1.100 3.4e-02
ependymoma -4.900 3.5e-03
glioblastoma -3.700 2.3e-07
group 3 medulloblastoma -4.300 7.1e-04
head and neck cancer -1.600 6.4e-03
interstitial cystitis 1.200 3.1e-02
invasive ductal carcinoma 1.287 1.2e-03
lung adenocarcinoma -1.100 1.8e-08
lung carcinoma -1.700 4.9e-29
medulloblastoma, large-cell -6.600 5.1e-06
nasopharyngeal carcinoma -1.400 1.9e-02
non-small cell lung cancer -1.578 1.8e-16
oligodendroglioma -2.300 2.3e-02
osteosarcoma -3.731 1.1e-04
ovarian cancer -1.700 6.4e-07
Pick disease -2.100 3.5e-02
primary Sjogren syndrome 2.300 1.6e-03
primitive neuroectodermal tumor -5.400 5.6e-07
progressive supranuclear palsy 1.100 4.8e-02
psoriasis -1.600 6.6e-09
sarcoidosis 1.200 5.2e-03
severe Alzheimer's disease -1.877 4.0e-02
subependymal giant cell astrocytoma -4.081 8.2e-03
tuberculosis 1.800 3.6e-09
Waldenstrons macroglobulinemia 1.516 3.4e-02

Gene RIF (223)

AA Sequence

DKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV                                 631 - 671

Text Mined References (328)

PMID Year Title