Property Summary

NCBI Gene PubMed Count 668
PubMed Score 212.15
PubTator Score 1382.62

Knowledge Summary

Patent (177,730)

Expression

  Differential Expression (22)

 OMIM Phenotype (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (427)

PMID Text
26826385 High P-PKCalpha expression in neoplastic gastric cancer biopsy samples as compared to nonneoplastic samples suggests that P-PKCalpha might act as an indicator of gastric cancer progression.
26769967 Prolonged membrane association/activation of PKCalpha is seen in self-renewing epithelium of the intestine, cervix, and skin.
26676968 RNA sequencing identified a novel ATPase, Ca2+ transporting, plasma membrane 4(ATP2B4)-protein kinase C-alpha (PRKCA) fusion transcript.
26671581 This study showed that SLC44A1-PRKCA fusion seems to be a specific characteristic of Papillary glioneuronal tumors with a high diagnostic value.
26662512 Kinocilium is essential for proper localization of Lgn, as well as Gai and aPKC, suggesting that cilium function plays a role in positioning of apical proteins critical for hearing.
26657401 Data show that bisindolylmaleimides (BIMs) Ro 31-8220 also blocks activity of the solute carrier organic cation transporter 1 (OCT1), involved in uptake of marketed drugs in the liver, in a protein kinase C (PKC)-independent manner.
26542395 PKCalpha is coupled to ATP-stimulated TMEM16A activation in biliary epithelial cells.
26398575 InB may exhibit growth-inhibitory activity through the activation of PKCalpha, followed by an increase in NFAT transactivation ability.
26350262 PKCalpha Attenuates Jagged-1-Mediated Notch Signaling in ErbB-2-Positive Breast Cancer to Reverse Trastuzumab Resistance
26304124 lipids mediate post-transcriptional regulation of HAMP through PKC- and HuR-dependent mechanisms
26300055 The results suggest that PKC-delta is an essential part of the apoptotic program in mesothelioma cells, whereas PKC-alpha mediates a pro-survival response to cisplatin.
26277396 Our data suggest that PKCalpha, beta and epsilon activation may underlie physiological and pathophysiological responses of alpha1-AR signaling for the phosphorylation of membrane-associated substrates including ion-channel and transporter proteins.
26256210 These data establish a role for FMNL2 in the regulation of beta1-integrin and provide a mechanistic understanding of the function of FMNL2 in cancer invasiveness.
26234676 we suggest that PKCA tightly controls TRM6/61 activity to prevent translation deregulation that would favor neoplastic development.
26160374 Syndecan-4 is essential for transmitting the mechanotransduction signals via activation of PKC-alpha and is important for tumor cells spreading, assembly of actin cytoskeleton and cell contractility.
26092940 this study identified PKC as the kinase that phosphorylates a specific site in the linker region of PACSIN2.
26063340 These results suggest that over-activated ERK and PKC pathways are involved in the P2Y2R-mediated invasion of breast cancer cells.
26056003 findings demonstrate that PKCalpha plays a critical role in HCC development by inducing DUOX2 expression and ROS generation, and propose a strategy to target PKCalpha/DUOX2 as a potential adjuvant therapy for HCC treatment
26044736 Aurora kinases ((Aurora kinase A and B )mediate PKC-MAPK signal to NF-kappaB/AP-1 with increasing MMP-9 expression and invasion of MCF-7 cells.
26033110 results indicate that PKC-mediated cortactin phosphorylation might be implicated in the maintenance of growth cone
26010542 These findings suggest that PKCalpha expression in HCC could be stimulated by the formation of MZF-1/Elk-1 complex, which directly binds to the PKCalpha promoter.
26009271 Taken together, our present study demonstrated that PKC regulates the function of OATP1B1 by affecting internalization and recycling of the transporter protein.
26009201 We present the current knowledge of protein kinase C (PKC)-dependent regulation of Cx43 and discuss the divergent results.
25924946 Our data also suggest that PKCalpha is important for both mesenchymal and amoeboid invasiveness, making it an attractive target for anti-metastatic therapies
25752336 Data indicate a direct correlation between the protein kinase C alpha (PKC-alpha) and ribonuclease III Dicer.
25724832 Whereas ectopic overexpression of PKCalpha in parental H1650 cells was not sufficient to alter the expression of EMT genes.
25693686 Data show that in K562 cells, the protein kinase C alpha (PKCalpha) and protein kinase C beta II (PKCbetaII) expressions enhanced in the presence of the drug when the growth was inhibited.
25691573 Data indicate that cellular glucose deprivation activates protein kinase C alpha-(PKCalpha) to induce both autophagy and degradation of beta-catenin.
25687755 Data indicate that rotein kinase calpha (PKCalpha) plays a role in downregulating complement receptor Ig (CRIg coded by V-set and Ig domain-containing protein 4 VSIG4) expression.
25675530 Endogenous NLGN4X is intensely phosphorylated on T707 upon PKC stimulation in human neurons.
25646356 The expression of protein kinase Calpha may be regulated by miRNA-328, which in turn may promote brain metastasis from lung cancer.
25613138 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25514083 These results show a key participation of PKCalpha and PKCdelta in progesterone receptor regulation and function.
25483185 The suppression of PKC activates the Chk1-mediated mitotic exit checkpoint in Nf1-deficient cells, leading to the induction of apoptosis via mitotic catastrophe.
25429624 the synapse-associated protein-97 (SAP97), an excitatory synapse scaffolding element, governs ADAM10 trafficking from dendritic Golgi outposts to synaptic membranes, mediated by a previously uncharacterized protein kinase C.
25391900 contributes to high NaCl-dependent activation of NFAT5 through ERK1/2
25362646 PKCa and Cyclin B1 are linked in a DAG-dependent mechanism that regulates cell cycle progression
25313067 KLHL3 is phosphorylated at serine 433 in the Kelch domain (a site frequently mutated in hypertension with hyperkalemia) by protein kinase C in cultured cells and that this phosphorylation prevents WNK4 binding and degradation.
25248616 INPP4B is a novel suppressor of oncogenic PKC signaling, further emphasizing the role of INPP4B in maintaining normal physiology of the prostate epithelium and suppressing metastatic potential of prostate tumors.
25233429 Data suggest that calcium-dependent phosphatidylinositol 4,5-diphosphate- (PI(4,5)P2-) binding proteins (such as PRKCA, SYT1 [synaptotagmin I], and ANXA2 [annexin A2]) interactions with membrane microdomains are tightly regulated. [REVIEW]
25225290 Activation of PKC-alpha and -delta mediates a novel positive feedback loop by promoting ErbB2 entry into the endocytic recycling compartment.
25138157 CD44/selectin binding signals increased intercellular adhesion molecule 1 up-regulation on the endothelial cells (ECs)surface through a PKCalpha-p38-SP-1 pathway, which further enhances melanoma cell adhesion to ECs during metastasis
25124796 The PKC/GSK-3beta signaling pathway controls both the stability and transcription of Snail, which is crucial for epithelial-mesenchymal transition induced by EGF in PC-3 and A549 cells.
25124035 These results are consistent with a model in which binding of OspE to PDLIM7 during infection regulates the activity of PKC isoforms that bind to the PDLIM7 LIM domain.
25122662 Whole exome sequencing followed by immunohistochemistry of fibrolamellar hepatocellular carcinoma cell lines and tumors showed two structural variants resulting in fusion transcripts: DNAJB1-PRKCA and CLPTM1L-GLIS3.
25080502 Functional variations modulating PRKCA expression and alternative splicing predispose to multiple sclerosis.
25058461 results suggest that the association of PKCalpha with the armadillo repeats of beta-catenin placed the Ser33/37/Thr41 residues of beta-catenin in close proximity to PKCalpha, thereby facilitating PKCalpha-mediated beta-catenin phosphorylation
25026300 T-ALL patients with PKCalpha down-regulation, compared to patients with PKCalpha levels above the threshold, presented a markedly increased cumulative incidence of relapse
24928086 The results demonstrate LPA-stimulated migration in oral carcinoma cells through LPAR3, mediated further by PKC, which acts either in concert with or independently of EGFR transactivation
24925028 PKC alpha is down-regulated by miR-200b in triple-negative breast cancer.
24898696 Results show that Wnt5a promoted epithelial-mesenchymal transition via PKCalpha in epithelial ovarian cancer.
24842701 PRKCA polymorphism changes the neural basis of episodic remembering in healthy individuals.
24841200 Knocking down Wnt5b expression reduced phospho-PKCA levels and cell migration.
24790081 Disruption of the homodimer results in a loss of PKC-mediated ERK1/2 phosphorylation, whereas disruption of the auto-inhibited state promotes the homodimer and prolongs PKC membrane localization.
24632200 By treatment of cells with octaarginine (R8), enhanced clustering of syndecan-4 on plasma membranes and binding of PKC-alpha to the cytoplasmic domain of syndecan-4 were observed.
24583280 Moreover, we have shown that phosphorylated catalytically competent PKCalpha is critical for U87 glioma cell viability in response to HypPDT treatment.
24574051 These findings call attention to PKC-mediated phosphorylation of alpha-tubulin as a novel mechanism for controlling the dynamics of microtubules that result in cell movement.
24560667 PKA turnover by the REGgamma-proteasome modulates FoxO1 cellular activity and VEGF-induced angiogenesis.
24559055 PKCalpha first docks to the membrane via its C2 domain, and then its C1A domain embeds itself in the bilayer.
24528886 Protein kinase C alpha signaling regulates netrin-1/UNC5B pathway in bladder cancer.
24510606 Results indicated that the two PRKCI SNPs were jointly associated with prostate cancer risk in an Eastern Chinese population.
24505490 The study reveals that PKC-alpha is the primary isoform mediating the activation of Nox5.
24410631 SNAIL expression was attenuated by knockdown of EGR-1, but upregulated by ectopic expression of EGR-1.
24401212 Hydroxytyrosol, at nutritionally relevant concentrations, reduces MMP-9 and COX-2 induction in activated human monocytes via PKCalpha and PKCbeta1 inhibition
24366551 PRKCA activity suppresses the level of ER-alpha expression by inhibiting c-JUN phosphorylation.
24336654 Calcium oscillations induced by activation of the Ca2+-sensing receptor in response to an increase in extracellular or exposure to the calcimimetic R-568 result from negative feedback involving PKCalpha-mediated phosphorylation of the CaR at Thr(888).
24316392 PKCalpha/beta is critical for PLCepsilon-mediated cancer cell invasion and migration
24297175 Differential protein kinase C-dependent modulation of Kv7.4 and Kv7.5 subunits of vascular Kv7 channels.
24225947 results suggest that PKCalpha can modify PP2A activity by phosphorylation of B56alpha at Ser(41). This interplay between PKCalpha and PP2A represents a new mechanism to regulate important cellular functions like cellular Ca(2+) homeostasis.
24219286 Elevation of protein kinase Calpha stimulates osteogenic differentiation of mesenchymal stem cells.
24040137 miR-203 inhibits cell proliferation and migration of lung cancer cells by targeting PKCalpha.
24029232 Protein kinase C alpha is a central signaling node and therapeutic target for breast cancer stem cells.
23977398 These results provide further support for the contribution of PKCs in Niemann Pick Type C1 disease pathogenesis.
23977066 Cysteinyl leukotrienes signaling downstream of CysLT1R in mast cells is differentially regulated by two distinct PKCalpha and PKC epsilon.
23900841 phosphorylated PKCalpha is a direct target for agonist-induced proteasomal degradation via an Hsp-regulated mechanism, and highlight the existence of a novel pathway of PKC desensitization in cells.
23898208 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
23893289 Data indicate that catalytically active non-structural protein 3 (NS3) NTPase/helicase can act in an analogous manner to shorter NS3 fragments as a pseudosubstrate inhibitor of protein kinase C (PKC).
23887639 Sirolimus-FKBP12.6 impairs endothelial barrier function by activation of protein kinase C-alpha and downstream disruption of the p120-VE cadherin interaction in vascular endothelium.
23882690 Active PKCalpha phosphorylates Src to induce PI-3K to phosphorylate AKT that subsequently activates the ERK1/2 cascade to stimulate goblet cell proliferation.
23867815 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
23844163 Data indicate that a PKCa-independent mechanism of IL6 gene activation is very sensitive to physical forces in thyroid cells cultured in vitro as monolayers.
23838138 These results suggest that serum activated PKCalpha is a good biomarker applicable to cancer diagnosis.
23824807 This study identifies PKCalpha, PKCepsilon, and vimentin as key factors affecting efficient infection and transduction by echovirus 1 and baculovirus, respectively.
23754287 A novel, time-dependent change in the relationship between total ERK and phosphorylated ERK levels that persists without negative feedback, is reported.
23680674 ATPgammaS induced prostaglandin E2 generation via a cPLA2/COX-2-dependent pathway.
23629676 The degradation of zonula occludens-1 (ZO-1), and claudin-2 exhibited a great dependence on the activation of the transient receptor potential melastatin (TRPM) 2 channel, phospholipase Cgamma1 (PLCgamma1) and the protein kinase Calpha (PKCalpha) signaling cascade.
23589289 Electrostatic and hydrophobic interactions differentially tune membrane binding kinetics of the C2 domain of protein kinase Calpha.
23536578 Knockdown of protein kinase C alpha and delta enhances nanog expression in cancer cell lines.
23526078 protein kinase C alpha was upregulated in kidney carcinoma.
23525101 PGE2-induced activation of angiogenesis is mediated via syndecan-4-dependent activation of PKCalpha.
23524339 PKC alpha plays central role in mediating HGF-induced fluctuant ERK-paxillin signaling, probably via the regulation of endosomal degradation of c-Met for the migration of HepG2.
23508961 novel and widespread mechanism of desensitization of PKCalpha signaling that involves endocytic trafficking and lysosome-mediated degradation of the mature, fully phosphorylated protein.
23468872 PKCalpha protein is upregulated in gastric carcinoma. PKCalpha protein expression is statistically correlated with age, histologic type, tumor differentiation, depth of invasion, angiolymphatic invasion, pathologic stage, and distant metastasis.
23401860 VEGF and PKC promote degradation-independent protein ubiquitination of FLNB to control intracellular trafficking of HDAC7.
23393340 These results suggest that serum activated PKCalpha is a reliable biomarker, applicable to lung cancer diagnosis.
23389293 PKC-alpha regulates claudin-1 via Snail- and mitogen-activated protein kinase/ERK-dependent pathways during EMT in pancreatic cancer.
23349388 A significant part of ROS production in sickle cells is mediated enzymatically by NADPH oxidase, which is regulated by protein kinase C, Rac GTPase, and intracellular Ca(2+) signaling within the sickle red blood cells.
23288845 PKC regulates the secretion of apoE from primary human macrophages
23201854 Activation of PKC is an important step in the translocation of ANCA antigens and C5a-induced activation of neutrophils by ANCA.
23114726 alpha-Tomatine inhibited 12-O-tetradecanoylphorbol-13-acetate-induced expressions of PKC-alpha in MCF-7 cells.
23098446 Down-regulation of protein kinase C-alpha is associated with drug resistance in ovarian cancer.
23070544 TNF-alpha up-regulates protein level and cell surface expression of the leptin receptor by stimulating its export via a PKC-dependent mechanism
23066026 Src family kinases, PI3 kinase and protein kinase C synergize to mediate Gq-dependent platelet activation
22969158 a negative feedback loop from PKCalpha that dampened PI3K activity and invasive behavior in cells with genetic hyperactivation of the PI3K pathway.
22919060 we provide evidence that PGF2alpha induces COX-2 expression via the FP receptor and phosphorylates CREB1 by PKC, thus increasing CREB1 binding to the COX-2 promoter and the expression of COX-2 in human amnion fibroblasts.
22898813 C. neoformans activates RhoGTPases and subsequently FAK, ezrin, and PKCalpha to promote their traversal across the HBMEC monolayer, which is the critical step for cryptococcal brain infection and development of meningitis.
22872490 Protein kinase C alpha plays a significant role in the maintenance of myometrial quiescence and must decrease at the end of pregnancy allowing myometrial activation.
22865467 These data indicate that EGFR and PKC are involved in mAChR-mediated activation of ERK1/2 and RSK and the subsequent proliferation of SNU-407 colon cancer cells.
22815910 d-alpha-tocopherol and d-gamma-tocopherol have opposing regulatory functions for ICAM-1-activated PKCalpha in endothelial cells
22797061 AnxA6 is a new PKCalpha scaffold to promote PKCalpha-mediated EGFR inactivation.
22773839 PKCalpha constitutes a crucial component of the integrin alphav-mediated pathway(s) that promote p53 relocalization and melanoma survival.
22732145 DGKtheta; translocation and activity is regulated by the concerted activity of EGFR and PKC.
22685300 APPL1 is a novel target in endoplasmic reticulum (ER) stress-induced insulin resistance and PKCalpha is the kinase mediating ER stress-induced phosphorylation of APPL1 at Ser(430).
22670899 Data from studies using recombinant proteins suggest that isoforms of PRKA (A kinase anchor protein 7) exhibit high-affinity interactions with isoforms of PKC (primarily PKCalpha and PKCbeta used here); AKAP7 could dictate PKC localization/function.
22653970 A LQT2-associated mutation can inhibit Kv11.1 ion channel activity by perturbing a consensus site for the Ser/Thr protein kinase C alpha (PKCalpha).
22639047 Over-expression and activity of endogenous PKC-alpha is closely associated with the regulation of the multidrug resistance phenotype in human colon cancer HCT15 cells.
22617682 High levels of CCL2 expressed in bladder cancer mediates tumor invasion and is involved with advanced tumorigenesis.
22586106 Results indicate a role for PKCalpha in memory and suggest a genetic link between memory and the risk for posttraumatic stress disorder (PTSD).
22582175 Protein kinase C alpha represents one of the early targets activated in response to pneumonia associated pneumolysin exposure in the lung.
22559731 Although the findings showed elevated expression of Elk-1 and PKCalpha in 5637 cells, the regulator of PKCalpha in bladder cancer cells is yet to be determined.
22537850 Protein kinase C stimulates human B cell activating factor gene expression through reactive oxygen species-dependent c-Fos in THP-1 pro-monocytic cells.
22536444 a novel role for PKCalpha in the regulation of stress granule formation during cellular stress
22532564 Data indicates that 2B15 requires regulated phosphorylation by both PKCalpha and Src, which is consistent with the complexity of synthesis and metabolism of its major substrate, DHT.
22532149 The result indicated that protein kinase Calpha was involved in knee osteoarthritic progression, along with the increase of cell apoptosis.
22475757 SZ95 sebocytes express the conventional cPKCalpha; the novel nPKCdelta, epsilon, and eta; and the atypical aPKCzeta
22469974 RhoGDI2 becomes rapidly phosphorylated at Ser31 in response to phorbol 12-myristate 13-acetate stimulation. Conventional type PKCalpha is responsible for this phosphorylation.
22407785 Reveal a central role for PKCalpha in cutaneous wound repair via changes in desmosomal adhesiveness.
22393054 phosphorylation by PKCalpha is critical for RalB-mediated vesicle trafficking and exocytosis.
22247259 New protein synthesis and trafficking through the Golgi are required for protein kinase C alpha-induced CD36 phosphorylation and blocked thrombospondin-1 binding, suggesting that phosphorylation probably occurs intracellularly.
22242955 expression higher in breast tumors than in the adjacent normal breast tissue
22242952 elevated expression of in breast cancer cells may be correlated with the potential of cell migration and invasion
22114277 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
22031842 VCAM-1 activation of endothelial cell NADPH oxidase/PKCalpha/PTP1B induces transient ERK1/2 activation that is necessary for VCAM-1-dependent leukocyte transendothelial migration.
22027822 Data establish the requirement of scaffolding to DLG1 for PKCalpha to promote cellular migration.
21957166 Exercise induces FXYD1 phosphorylation at multiple sites in human muscle; in mice, contraction-induced changes in FXYD1 phosphorylation are fiber-type specific and dependent on protein kinase Calpha activity.
21952047 PKC alpha regulates Sendai virus-mediated interferon induction through HDAC6 and beta-catenin
21903576 PKC-mediated remodeling of the actin cytoskeleton is likely regulated by the ability of SSeCKS to control PKC signaling and activity through a direct scaffolding function
21895402 High levels of protein kinase C alpha expression were associated with cellular differentiation in squamous cervical cancer.
21873429 Ca(2+) influx through reverse mode NCX is required for the activation and the targeting of PKCalpha to the plasma membrane, an essential step for VEGF-induced ERK1/2 phosphorylation and downstream EC functions in angiogenesis
21840882 Tauroursodeoxycholate inhibits neointimal hyperplasia by reducing proliferation and inducing apoptosis of smooth muscle cells by suppression of ERK via PKCalpha-mediated MKP-1 induction.
21829170 The authors have identified a protein kinase C (PKC) phosphorylation site within the cytoplasmic domain of the beta-subunit of the GlyR (residue S403) that causes a reduction of the binding affinity between the receptor and gephyrin.
21825068 These findings demonstrate that specific host factors involving cPLAalpha and cysteinyl LTs contribute to type III GBS penetration of the blood-brain barrier and their contribution involves PKCalpha.
21741352 the effect of curcumin on PKCalpha activity was related to its effect on the membrane, which may modulate the binding of the enzyme to the membrane.
21735098 PKCalpha is involved in the CCR7/NF-kappaB autocrine signaling loop in squamous cell carcinoma of head and neck.
21720730 The results demonstrate that PKCalpha suppresses the expression of STC1 in breast cancer cells.
21712053 The nuclear binding of pri-microRNA 15a is a novel function of protein kinase C alpha, which plays an important role in endothelin-1 mediated signaling.
21705328 Dual function of protein kinase C (PKC) in TPA-induced MnSOD expression: activation of CREB and FOXO3a by PKC-alpha phosphorylation and by PKC-mediated inactivation of Akt, respectively.
21658388 Data indicate that pure curcumin attenuates WT1 auto-regulatory function through inhibition of PKCalpha signaling in K562 cells.
21651489 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
21576361 Data show that PKCalpha activation elicits a cascade of orchestrated phosphorylation events that may modulate eIF4G1 structure and control interaction with the eIF4E kinase, Mnk1.
21482705 A novel pathway of Btk regulation via protein kinase C phosphorylation of IBtkgamma.
21474332 capsaicin-mediated IL-6 increase in prostate cancer PC-3 cells is regulated at least in part by TNF-alpha secretion and signaling pathway involving Akt, ERK and PKC-alpha activat
21448905 Overexpression of PRKCA is associated with non-small cell lung cancer with brain metastasis.
21389833 PKCalpha is the major contributory factor in melanoma vasculogenic mimicry.
21386996 PKCalpha is the key participant in the activation of ADAM17.
21354279 The anti-invasive effects of piperine may occur through inhibition of PKCalpha and ERK phosphorylation and reduction of NF-kappaB and AP-1 activation, leading to down-regulation of MMP-9 expression.
21323641 PKC-alpha and -betaI play critical roles in the epithelial-mesenchymal transdifferentiation of renal tubular epithelial cells in response to urinary proteins.
21321125 PKC alpha mediates beta-arrestin2-dependent nephrin endocytosis in hyperglycemia.
21156808 SERCA2-deficiency is sufficient to impede desmosome assembly and weaken intercellular adhesive strength via a PKCalpha-dependent mechanism, implicating SERCA2 as a novel regulator of PKCalpha signaling
21113078 Nuclear localization of phospholipase D1 mediates the activation of nuclear protein kinase C(alpha) and extracellular signal-regulated kinase signaling pathways.
21106355 JNK might be an important downstream target of PKCalpha in multidrug resistance in breast cancer
21090097 Abnormal expression of Bcl2, Bax and PKC in nasal polyp tissues might play an important role in the occurrence and progression of nasal polyps.
20940303 PKC-dependent phosphorylation of the alpha4 subunit plays a significant role in enhancing the cell surface stability and activity of GABA(A)R subtypes that mediate tonic inhibition
20842205 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
20819076 Results reveal novel signalling cross-talk, whereby RACK1 mediates PKC-dependent activation of PDE4D5 in the particulate fraction of HEK-293 cells in response to elevations in intracellular cAMP.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20815813 Results provide evidence for both physical and functional interactions between the PKC and Fbw7 families, and yield insights into the isoform-specific regulation of Fbw7alpha.
20691662 these results suggest that PKC-alpha is a candidate for PDK-2 in T cells upon TCR stimulation.
20689063 Production of the PKCalpha C-terminal fragment in ischemic hearts occurs via a receptor-independent mechanism
20673527 The results suggest ERCC1 and PKCalpha might be correlated with the development of NSCLC. ERCC1 might be related to prognosis of non-small cell lung cancer.
20618341 intracellular Francisella tularensis novicida triggers temporal and early activation of Ras through the SOS2/GrB2/PKCalpha/PKCbetaI quaternary complex; Ras signalling by intracellular F. tularensis is essential for intracellular proliferation in the cytosol
20513439 These results confirm the novel possibility that PKCalpha is a direct substrate of Erk1/2 in neuronal cells and help link two important signaling molecules that regulate maturation and protection of hippocampal neurons as well as many other cell types.
20506636 Activation of PKC reduced expression of NOS3 in endothelial cells treated with oleic acid.
20486122 Three different isotypes of protein kinase C, i.e. PKC-alpha, PKC-eta and PKC-theta, were found to be regulated and translocated in opposite directions upon apoptosis induction.
20458747 The application of flavonoids to prevent the migration/invasion of glioblastoma cells through blocking PKCalpha/ERK/NF-kappaB activation is demonstrated.
20453000 Observational study of gene-disease association. (HuGE Navigator)
20444294 PKCalpha and ERK pathways play an important role in activating miR-101 expression, reducing PRC2 complex and H3K27me3 levels in HepG2 hepatoma cells.
20433920 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
20430034 Activation of PKCalpha by phorbol esters or thymeleatoxin causes a transient increase of arginine transport through system y(+), referable to the induction of SLC7A2 mRNAs and to the increased expression of CAT2 transporters.
20426528 promotes the proliferation of human airway smooth muscle cells sensitized with atopic asthmatic serum via up-regulation of cyclin D1 expression
20422977 Overexpression of IGF-IR and PKC may play an important role in the carcinogenesis and development of laryngeal squamous cell carcinoma.
20419132 PKCalpha is involved in reduction of nephrin surface expression; activation of PKCalpha is a pathomechanistic key event during the development of diabetic nephropathy
20407865 Increased expressions of PKCalpha and cyclin D1 might be involved in the pathogenesis of abnormal proliferation of pulmonary artery smooth muscle cells in smokers with normal lung function and smokers with mild to moderate COPD.
20398285 PKCalpha is a marker for poor prognosis of breast cancer
20385812 Phosphorylation of S(695) by PKC or introducing a phosphomimetic aspartate at this position (S(695)D) renders BK channels insensitive to the stimulatory effect of PKG or PKA.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20350647 risk of preterm delivery that is associated with tag polymorphisms in genes that regulate the inflammatory response is modified by an environmental exposure such as bacterial vaginosis
20350647 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20346360 Observational study of gene-disease association. (HuGE Navigator)
20336759 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
20333651 TNF-alpha induces MMP-9 expression via the TNFR1/TRAF2/PKCalpha-dependent JNK1/2/c-Jun and c-Src/EGFR/PI3K/Akt pathways.
20216103 PKC-alpha plays an important role in melanoma cell migration
20149875 Data suggest that phosphorylation of S26 is the primary mechanism through which PKCalpha modulates cardiac stiffness.
20145126 Mda-9/syntenin acts as a molecular adaptor linking PKCalpha and FAK activation in a pathway of FN adhesion by human cancer cells.
20141446 Am80 inhibits surface CXCR4 expression and SDF-1-induced chemotaxis by the acceleration of CXCR4 internalization via activation of conventional PKC
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20032081 The anti-angiogenic effect of PPARgamma agonists is due, at least in part, to an interference with the VEGF-stimulated PKCalpha-mediated activation of CREB and the related expression of COX-2.
20030858 The results demonstrate that pathogenic mycobacteria recognize and then inhibit PKCalpha via the action of PknG to circumvent phagocytosis and the hostile environment of macrophages.
20011080 These results suggest that PKC(alpha) affects cell cycle progression and proliferation in human RPE cells through the downregulation of p27(kip1).
19950169 Data demonstrate that PKC-alpha is induced by several MyD88-dependent TLR/IL-1R ligands and regulates cytokine expression in human and murine DC.
19895572 PMA-responsive cPKC isoforms (alpha, beta and gamma) play a key role in negative regulation of CD98 signalling and homotypic aggregation
19855090 Results show that IGF-IR can inhibit PKC-alpha gene transcription and thereby block the synthesis of PMA-regulated MMPs, suggesting that within the same cells, IGF-IR can act as both a positive and negative regulator of MMP expression and function.
19825989 Modulation of PKCalpha by histamine receptors may be important in regulating cholangiocarcinoma growth.
19801684 Data show that stimulation of HIF-1alpha transcription by the ND6 mutation was mediated by overproduction of reactive oxygen species (ROS) and subsequent activation of phosphatidylinositol 3-kinase (PI3K)-Akt and protein kinase C (PKC) signaling pathways.
19794964 Data show that PKCalpha was slightly elevated in HUVECs exposed to UKF-NB-4.
19786960 We conclude that, although we have obtained convergent lines of evidence implicating both rare and common schizophrenia risk variants at PRKCA, none of these is individually compelling
19712589 SH2D4A inhibited cell proliferation by suppression of the ERalpha/PLC-gamma/PKC signaling pathway.
19698232 PKC activation can up-regulate CD44 expression by phosphorylation in human erythrocytes.
19681907 YadA and invasin of Yersinia pseudotuberculosis both trigger signal transduction pathways during integrin-mediated phagocytosis into epithelial cells, which lead to the activation of Akt, PLC-gamma1, PKCalpha and -beta downstream of PI3 kinase.
19672862 Overexpression of Protein kinase C alpha is associated with endometrial cancer.
19655190 PKCalpha- and PKCepsilon-mediated phosphorylation of cMyBP-C and cTnI as well as cTnT decrease myofilament Ca2+ sensitivity and may thereby reduce contractility and enhance relaxation of human myocardium.
19639961 molecular mechanism for the regulation of FR recycling through PKC
19635931 The cascade of events initiated by hog dust exposure is mediated by PKC-alpha/-epsilon and ultimately results in the release of TNF-alpha.
19626679 The functional analysis on the relationship between CCh-induced calcium response and endogenous PKCalpha expression might be helpful to predict the development of melanoma.
19609943 Data imply that targeting CAV1 and/or PKCalpha may allow the development of new molecular therapeutic strategies to improve the treatment outcome for patients with ESFT.
19592459 Mutation of protein kinase C phosphorylation site S1076 on alpha-subunits affects BK(Ca) channel activity.
19576566 PRKCA is a pleiotropic locus that is associated with both BMI and asthma and that has been identified via linkage analysis of BMI in a Costa Rican population with asthma.
19523156 ESI-MS analysis and cellular expression of PB1-F2 mutants identified the positions Ser-35 as the major and the Thr-27 as an alternative PKC phosphorylation site.
19509063 Results show that the expression of PKCalpha in proliferating intestinal epithelial cells is repressed both in vitro and in vivo by the SOX9 transcription factor.
19459855 PKCA-responsive polymeric carrier: its application for gene delivery into human cancers is reported.
19449091 These results suggest that LeY oligosaccharide acts as a signal molecule to modulate diacylglycerol/PKC signaling pathway.
19363595 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
19357285 N-cadherin cleavage is regulated by a PKC-alpha-metalloproteinase ADAM-10 cascade in glioblastoma (GBM) cells and may be involved in mediating GBM cell migration.
19340015 PKCalpha activation is both necessary and sufficient to trigger irreversible growth arrest during human epidermal keratinocyte differentiation.
19324950 PKC(alpha) and PKC(epsilon) differentially regulate Legionella pneumophila-induced GM-CSF
19324870 A functional polymorphism that impairs the activity of PHLPP2 and correlates with elevated Akt phosphorylation and increased PKC levels, was identified.
19291828 PKCalpha positively regulates multidrug resistance(MDR) in a stomach cancer cell line and inhibition of PKCalpha can partially attenuate MDR in human gastric cancer cells.
19235902 Protein kinase C alpha (PKCalpha) regulates growth and invasion of endometrial cancer cells.
19176518 EGFR signals to mTOR through PKC and independently of Akt in glioma
19158275 p73 is able to induce cell cycle arrest independently of its amino-terminal transactivation domain, whereas this domain is crucial for p73 proapoptotic functions.
19116345 Evidence suggesting that SPHK enhances migration of ML-1 cells by an autocrine mechanism and that the S1P-evoked migration is dependent on protein kinase C alpha, ERK1/2, and SPHK.
19097143 These results demonstrated that in A549 cells, activation of p50/p65 heterodimer through sequential activation of PKC alpha-JNK-NIK-IKK beta-NF-kappaB was required for IL-1 beta-induced uPA expression associated with migration of tumor cells.
19088254 ANG II inhibited hOAT1 activity through activation of PKCalpha, which led to the redistribution of the transporter from the cell surface to the intracellular compartments.
19087983 Protein kinase Calpha levels are elevated in the pregnant myometrium suggesting the involvement of protein kinase Calpha in regulation of human uterine contraction.
19086053 Observational study of gene-disease association. (HuGE Navigator)
19073232 These results provide evidence for the existence of a cAMP-dependent but PKA-independent pathway in mediating the endothelial cell-conditioned medium-induced aldosterone release and the significant influence of more than one signaling mechanism.
19060919 ezrin is regulated during osteosarcoma metastasis by PKC
19056838 An investigation of the marine compound spongistatin 1 links the inhibition of PKCA translocation to nonmitotic effects of tubulin antagonism in angiogenesis.
19029835 findings support a model in which activation of PKCalpha downregulates ATM protein and delays tumor growth in prostate cancer cells.
18991684 findings shed light on post-transcriptional regulation of HSP70 expression, suggesting a molecular cascade involving PKC/HuR/HSP70- that possibly represents an early event in the cellular response to oxidative stress in SH-SY5Y human neuroblastoma cells
18983267 The direct interaction of PI3Kgamma with PKCalpha forms a discrete regulatory module of N-formylmethionyl-leucyl-phenylalanine-dependent reactive oxygen species production in neutrophils.
18950621 PDGFR-mediated phosphorylation at this site is dependent on PKCalpha, a conventional PKC isoform implicated previously in disruption of adherens junctions.
18755856 phosphorylation of FXR induced by PKCalpha directly modulates the ability of agonists to activate FXR
18660489 Observational study of gene-disease association. (HuGE Navigator)
18637128 The expression of P-cadherin (a marker of proliferating keratinocytes) was regulated by all of the examined protein kinase C isoenzymes, also in an antagonistic manner (inhibited by cPKCalpha/nPKCdelta and stimulated by cPKCbeta/nPKCepsilon).
18632858 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
18622039 Akt-mediated phosphorylation modulates eNOS uncoupling and greatly increases O(2)* generation from the enzyme at low Ca(2+) concentrations, and PKCalpha-mediated phosphorylation alters the sensitivity of the enzyme to other negative regulatory signals.
18577246 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
18566014 A novel interferon-independent pathway involving protein kinase C (PKC)-alpha activation, upstream of p38 and c-jun N-terminal kinase, is responsible for poly (I:C) pro-apoptotic effects on LNCaP cells.
18534651 A 46kDa variant of ERalpha increased in abundance in the cell membrane within 20 minutes of estradiol treatment suggesting that ERalpha mediated the estradiol non-genomic effects on PKCA through the formation of a membrane-associated signalling complex.
18503554 TRPV1 mediates heat shock-induced MMP-1 expression via calcium-dependent PKCalpha signaling in HaCaT cells
18489726 These results suggest a significant role of PKCalpha and downstream actin filament activity during the fungal invasion into human brain microvascular endothelial cells.
18474624 PKP2 knockdown is accompanied by increased phosphorylation of PKC substrates, raising the possibility that global alterations in PKC signaling may contribute to pathogenesis of congenital defects caused by PKP2 deficiency.
18434368 IGF-II/mannose-6-phosphate receptor signaling induced cell hypertrophy and atrial natriuretic peptide/BNP expression via Galphaq interaction and protein kinase C-alpha/CaMKII activation in H9c2 cardiomyoblast cells.
18401527 Thus, survivin, Smac, and PKC alpha might play important roles in the inhibition of apoptosis by FGF-2 in human small cell lung cancer cells.
18372343 A novel regulatory signaling mechanism of transcriptional control in which the LHR is derepressed through PKCalpha/ERK-mediated Sp1 phosphorylation, causing the release of HDAC1/mSin3A complex from the promoter.
18372238 Protein kinase C alpha modulates liver X receptor alpha transactivation.
18354190 modulation of PKC may have therapeutic potential in the prevention of smoke-related lung injury
18314869 Overexpression of protein kinase Calpha mRNA is associated with gastric carcinoma
18292781 Data show that NG2 and integrin alpha4 oppositely regulate anoikis in fibroblasts, and that NG2 and integrin alpha4 regulate FAK phosphorylation by PKCalpha-dependent and -independent pathways, respectively.
18281137 Observational study of gene-disease association. (HuGE Navigator)
18239055 In pancreatic tumor cells calcium-dependent PKC-alpha mediates TGF-beta-induced transcriptional downregulation of PTEN, and this pathway promotes cell migration in a SMAD4-null environment.
18206668 RXR ligands rapidly inhibit high-glucose-induced oxidative stress by antagonizing high-glucose-induced PKC activation, and cytoplasmic RXRalpha is implicated in this regulation
18184679 Moraxella catarrhalis infection activates protein kinase C and its isoforms alpha, epsilon and theta, which differentially regulate interleukin-8 transcription in human pulmonary epithelial cells.
18162471 discrete PKCs trigger distinctive responses when activated in different phases of the cell cycle via a common mechanism that involves p21 Cip1 up-regulation.
18089814 Ro3582 inhibits cell proliferation and activates bone morphogenetic protein/Smad signaling via a Ras and PKC alpha pathway in breast epithelial cells.
18056764 Protein kinase C alpha promotes angiogenic activity of human endothelial cells via induction of vascular endothelial growth factor.
17974965 Study shows that activation of protein kinase C-alpha (PKC-alpha) phosphorylated and down-regulated LRP expression.
17951978 findings provide the first evidence that stimulation of P-selectin surface expression via PKCalpha-dependent PKD2 activation could be an important mechanism in the early onset of AII-initiated endothelial adhesiveness.
17936705 Data show that expression of DMPK-CUG-repeat RNA results in hyperphosphorylation and stabilization of CUGBP1, and suggest that inappropriate activation of the PKC pathway contributes to the pathogenic effects of a noncoding RNA.
17934063 These results suggest that the PKCalpha isoform is an important regulator of cell migration in response to agricultural dust exposure.
17923691 The protein kinase C (PKC) inhibitor and apoptotic inducer staurosporine switches the production of Bcl-x towards the x(S) mRNA isoform in 293 cells.
17904606 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
17828490 Ginkgo Biloba extract may decrease the activation of the PKCalpha in the inflammatory cells and thereby decrease the IL-5 level in induced sputum of asthmatic patients.
17786270 Hemoglobin promptly and markedly modified the levels of expression of both calcium-dependent PKCalpha and calcium-independent PKCzeta.
17724468 PKC alpha, rather than other protein kinase C isoforms, participates in lysophosphatidic acid-induced NF-kappa B activation and urokinase upregulation in ovarian cancer cells.
17689692 PKC-alpha is the predominant conventional PKC present in the human coronary and skeletal microcirculation
17666590 analysis of direct binding and activation of PKCalpha and PKCdelta by steroid hormones and the molecular mechanisms involved
17632570 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
17591920 Differential phosphorylation of NG2 proteoglycan by ERK and PKCA helps balance cell proliferation and cell movement.
17588800 Determination of PKC-alpha levels/activity in leukaemia seems to be relevant when choosing efficient chemotherapy protocols based on the use of apoptosis-inducing anticancer drugs.
17545611 HER2 overexpression in HER2 2+ carcinomas is associated with neither an increase in gene transcription nor a deregulation in the ubiquitin-dependent pathways, but instead seems to be regulated by protein kinase Calpha (PKCalpha) activity.
17525530 STAT3 and PKC differentially regulate telomerase activity during megakaryocytic differentiation of K562 cells.
17459358 Protein Kinase C alpha mRNA was significantly increased in human hepatocellur carcinomas as compared to corresponding non-cancerous liver tissues.
17455194 the cell fate commitment of CD14(+)monocytes towards MDMs or MoDCs appears to be steered by the selective activation of PKCalpha or PKCbeta(I), respectively.
17438848 AP-1 may participate in the signal transduction of PKC-triggered expression of IL-5 in allergic rhinitis T lymphocytes.
17341442 These data demonstrate that IGF-I induces COX-2 expression in human ovarian cancer cells, which is mediated by three parallel signaling cascades--PI3K, MAPK, and PKC pathways that differentially regulate COX-2 expression.
17334233 "PKCalpha-NF- kappaB"-dependent cascade is involved in the signaling leading to phorbol myristate acetate-induced matrix metalloproteinase-9 expression in the lung epithelium
17321722 These data suggest that an intracellular calcium store independent PKC-Sp1 signaling pathway induces early keratinocyte differentiation through upregulation of TSG101.
17307332 Conventional PKC isoforms, especially PKCalpha, mediate feedback inhibition of G-protein-coupled receptor -induced EGFR transactivation.
17255356 Ras is able to promote monocyte lineage selection via PKC.
17212360 These results suggest that different PKC isoforms may exert ontogenetic-specific functions in erythropoiesis and that modulation of PKCalpha might affect the activity of (A)gamma-promoter-driven reporters.
17197445 Galphaq activation of TRPC6 signals the activation of PKCalpha, and thereby induces RhoA activity and endothelial cell contraction
17171646 Data suggest that MCF-7 cell proliferation or the anti-cancer action of doxorubicin and vinblastine on breast cancer cells is independent of PKC-alpha.
17157935 alpha-PKC and beta-PKC are required for optimal O(2)(-) generation, but play different roles in Ca2+ signaling for phagocytic responses such as O(2)(-) generation
17061041 a functional contribution of PKCalpha to tamoxifen resistant growth of human breast cancer cells
16984735 NT uses PKC-dependent pathways to modulate GSK-3, which may play a role in the NT regulation of intestinal cell growth
16979586 These results show for the first time that IP6 represses telomerase activity in prostate cancer cells by posttranslational modification of TERT via the deactivation of Akt and PKCalpha.
16964312 PCK-alpha activation in keratinocytes is a crucial event orchestrating cutaneous neutrophil responses.
16963226 Our data suggest that PKCalpha, but not PKCbeta, is the predominant cPKC isoenzyme required for cPLA(2) protein phosphorylation and maximal induction of cPLA(2) enzymatic activity upon activation of human monocytes.
16942862 We conclude that compound 48/80 is an effective activator of PI 3-kinase dependent pathways, leading to the activation of effectors including PKB/Akt, p70(S6K) and PKCalpha.
16939222 WISP-2/CCN5 is a novel signaling molecule that critically participates in the mitogenic action of PMA on noninvasive, WISP-2/CCN5-positive breast tumor cells through PKCalpha-dependent, multiple molecular signal transduction pathways.
16890208 RLIP76-/- mouse embryonic fibroblasts were resistant to PKCalpha-depletion mediated growth inhibition, as well as to the PKCalpha-dependent mitogen, phorbol 12-myristate 13-acetate (PMA).
16836077 The overexpression of protein kinase CK2alpha is closely related to the formation and development of laryngeal squamous cell carcinoma.
16775601 Incubation of podocytes with membranous glomerulonephritis sera determined strong upregulation of pPKC-alpha/beta that was reverted by pre-incubation with clusterin
16751194 PKC regulates sequestration of recycling molecules into this compartment, the pericentrion; PKC acted distal to the site of internalization of endocytic cargo
16710050 In conclusion, although CDCA and UDCA activate different PKC isoforms, PKCalpha plays a major role in the bile acid-induced inhibition of cAMP synthesis in fibroblasts.
16697522 PKCalpha activation is a critical step in androgen receptor nuclear exclusion by melatonin.
16673150 effect of insulin is dependent on activation of PKCalpha and/or PKCbeta, and these insulin signals may interfere with the dynamic assembly/disassembly and/or distribution of F-actin, which is required for the phagocytosis process
16642043 PKC alpha mmodulates Bcl2 phosphorylation and is relevant to chemoresistance in acute myeloid leukemia
16620963 Inhibition of Protein Kinase C represents a mechanism by which high tyrosine kinase activity can enhance cellular Ca(2+) transients and thus exert profound effects on the proliferation, apoptosis and chemotaxis of leukemic cells.
16571380 Data show that protein kinase C-alpha activation in endothelial cells leads to upregulation of sphingosine kinase-1 expression and activity, which is critically involved in the mechanism of endothelial cell migration.
16517978 increased expression of PKC-alpha and -betaI leads to increased total classical PKC kinase activity; increased activity of the isoenzymes plays a role in accelerated growth of TCC. In carcinoma tissue, PKC expression and activity are under strict control.
16338977 protein phosphorylation and dephosphorylation via PKC and the corresponding protein phosphatases contribute to phosphatidylserine exposure and erythrocyte shrinkage after energy depletion
16300929 Thrombin is able to induce activation of caspases 3 and 9 in human platelets and significantly increases the amount in the cytoskeleton of the active forms of both caspases and the procaspases 3 and 9.
16297876 PKCalpha expression may be modulated by Elk-1 and MZF-1 at the transcriptional level.
16236797 Ca2+-activated PKCalpha and its isolated C2 domain localize exclusively to the plasma membrane
16099831 PKC stimulation upregulates neuron-specific ELAV (nELAV) proteins (HuB, HuC, and HuD), and induces nELAV proteins to colocalize with the translocated PKCalpha isozyme on the cytoskeleton, with a concomitant increase of nELAV threonine phosphorylation.
16087181 Results identify targets in RLIP76 for phosphorylation by protein kinase C alpha, which may act as substrates for differential transport of doxorubicin.
16081872 PKCalpha stimulates NO production in endothelial cells and plays a role in regulation of blood flow in vivo.
16080189 The data do not support a strong association between single nucleotide polymorphism of PRKCA and spina bifida risk.
16079140 PKCalpha C1A-C2 interdomain interactions have a role in lipid-mediated PKCalpha activation
16006559 PRKCA-dependent PRKD1 activation modulates ERK signal pathway and endothelial cell proliferation by vascular endothelial growth factor A.
15917995 PKCalpha is specifically required for TPA-induced ERK(MAPK) signaling to trigger gene expressions of p15(INK4b) and p16(INK4a) leading to HepG2 growth inhibition
15814724 Inhibition of the oxidative burst, i.e., cellular desensitization, was clearly reversed in cells overexpressing PKC alpha, pointing to PKC alpha as the major transmitter in eliciting the oxidative burst in monocytes/macrophages.
15757899 NAG-1 expression is up-regulated by TPA in LNCaP cells through a PKC-dependent pathway involving the activation of NF-kappa B
15691837 Results demonstrate that a branched signaling pathway involving MEK, ERK, PKCepsilon, PKCalpha, and caveolin-1 regulates collagen expression in normal lung tissue and is perturbed during fibrosis.
15689238 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
15627650 two fatty acids inhibited the phorbol 12-myristate 13-acetate (PMA)-induced plasma membrane translocation of protein kinase C (PKC)-alpha and -epsilon
15613483 Epidermal and hepatocyte growth factors, but not keratinocyte growth factor, modulate protein kinase Calpha translocation to the plasma membrane
15603822 protein kinase C has a role in chitosan glutamate-mediated tight junction disruption
15583006 there is a complex interplay between PKCalpha, Syk, and Src involving physical interaction, phosphorylation, translocation within the cell, and functional activity regulation
15576373 Calpha activation and phosphorylation of syntaxin 4 and Munc18c are required for the cell surface expression of P-selectin and the consequent binding of neutrophils to endothelial cells.
15572354 diacylglycerol-responsive PKC isoforms differentially influence CaR agonist-induced release of Ca2+ from internal stores
15564481 colocalizes with virus particles and is required for Respiratory syncytial virus (RSV) fusion to the cell membrane of bronchial epithelial cells
15563462 protein kinase Calpha transcriptional repression via Sp1 by wild type p53 is involved in inhibition of multidrug resistance 1 P-glycoprotein phosphorylation
15555220 we used publicly available gene expression array data to further understand PKC-a-associated gene expression profiles in NSCLC
15531915 Ets1 serves as an effector for PKCalpha to fulfil certain functions in cancer ce
15509588 central role of PKC isoforms and the negative regulatory function of c-Src in the control of stromelysin 3 expression
15504744 PKC-alpha-mediated NG2 phosphorylation at Thr(2256) is a key step for initiating cell polarization and motility
15499829 We analyzed the dependence of the expression of some selected protein kinase C isoenzymes on the availability and/or action of androgens.
15488737 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
15456937 Results propose a new mechanism by which lithium indirectly inhibits glycogen synthase kinase-3beta via phosphatidylinositol 3 kinase-dependent activation of protein kinase C alpha.
15284224 Use of PKC agonists and isozyme-specific pseudosubstrate peptide antagonists suggested a role for PKCalpha and -epsilon in VEGF-mediated DAF up-regulation, mediating A cytoprotective pathway in ECs.
15277524 autophosphorylation of PKCalpha limits its sensitivity to DAG; kinase inhibitors augment the DAG sensitivity of PKCalpha by destabilizing the closed conformation
15272003 phosphorylation of LRP by PKCalpha modulates the endocytic and signaling function of LRP by modifying its association with adaptor proteins
15233804 Results suggest that the involvement of protein kinase C alpha in carbachol-induced soluble amyloid precursor protein (sAPPalpha) release is negligible, but PKC epsilon may be important in coupling cholinergic receptors with APP metabolism.
15192100 protein kinase C alpha, iota, and theta binding to L-selectin cytoplasmic domain is modulated by receptor phosphorylation
15169840 PKCA has a major role in cytoskeleton-dependent avidity modulation of ALCAM.
15159477 There was expression of protein kinase C alpha in abnormal muscle fibers. Protein kinase C isoforms may play a role in the pathogenesis of myofibrillar myopathy.
15155525 Observational study of gene-disease association. (HuGE Navigator)
15123666 PKD activation plays a central role in NT peptide secretion; upstream regulators of PKD include PKC-alpha and -delta and Rho/ROK
15051732 PKCalpha-S100C/A11-mediated pathway is involved in and essential for the growth inhibition of normal human keratinocytes cells by TGFbeta1.
14960580 PKC alpha is a critical regulatory element that is required for efficient regulatory volume decrease in HeLa cells
14739142 Only PKC-alpha is involved in the signal transduction cascade leading to neutrophil transepithelial migration.
14709334 PKC-alpha and PKC-epsilon act cooperatively in regulating JNK activation in response to PMA
14606067 in gastric cancer, protein translocation of PLCgamma2 and PKCalpha is critical event in the process of apoptosis induction.
14527960 PKCalpha and betaII have roles in the regulation of membrane recycling
12972622 PKCA acts upstream of PKCtheta to activate IkappaB kinase and NF-kappaB in T-lymphocytes.
12960759 there is an impairment of degradation of protein kinase c alpha in huntington disease 150q cells that is connected with the sequestration of proteasome on mutant huntingtin aggregates
12954613 the affinity of isolated C1A and C1B domains of PKCalpha and PKCgamma for soluble and membrane-incorporated DAG and phorbol ester were measured by isothermal calorimetry and surface plasmon resonance in order to compare activation mechanisms
12952980 protein kinase C alpha signaling is activated by apolipoprotein A-I, and it has a role in phosphorylation and stabilization of ATP binding cassette transporter A1 for the high density lipoprotein assembly
12907651 Loss of protein kinase Calpha expression may enhance the tumorigenic potential of Gli1 in basal cell carcinoma.
12890670 PKC alpha phosphorylates diacylglycerol kinase zeta in cells, and this phosphorylation inhibits its kinase activity to remove cellular diacylglycerol, thereby affecting cell growth.
12878187 Protein kinase C alpha negatively regulates cell spreading and motility in breast cancer cells.
12839565 protein kinase C alpha associates with phospholipase D1 and enhances basal phospholipase D activity in a protein phosphorylation-independent manner in melanoma cells, which contributes to the cell's high invasive potential.
12824193 Protein kinase C promotes apoptosis in LNCaP prostate cancer cells through activation of p38 MAPK and inhibition of the Akt survival pathway
12783114 The novel varepsilon and eta and atypical zeta, but not the conventional alpha and beta and the novel delta PKCs, may be involved in the signaling pathways involved in thrombin-induced human platelet P-selectin expression
12754211 data demonstrate a pathway of Rho activation involving protein kinase c alpha-dependent phosphorylation of p115Rho guanine exchange factor
12724315 PKCalpha is involved in the regulation of Ca2+-induced platelet aggregation.
12704190 Filamin A was identified as a direct binding partner of protein kinase Calpha; two binding sites were identified on filamin A; a Ca2+ and phospholipid-dependent association of the regulatory domain of protein kinase C with these sites was revealed.
12652652 PKC alpha plays a necessary role in mediating calcium-induced differentiation. Failure to regulate PKC alpha in SCC4 carcinoma cells may underlie at least part of the failure of calcium to promote differentiation in these cells.
12632071 PKCalpha may regulate Ets1 activity in invasive breast cancer cells
12610653 the direct PKC-dependent activation of the amyloid protein precursor secretory pathway is compromised by reduced PKCalpha expression and a specific role of this isoform in these mechanisms
12536241 Il-2 increased protein kinase C alpha expression, but polysaccharide K decreased it.
12490289 greater increase of PKCalpha translocation after PMA treatment in breast cancer erythrocytes compared to controls was observed
12482669 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
12412804 Our findings present original data that PKCalpha is the isoform specifically involved in the proliferation of primary human osteoblasts.
12372816 Activation of PKCalpha stabilizes F-actin and thereby opposes the effect of PKCepsilon on membrane remodeling in T84 cells.
12372800 Protein kinase C alpha plays an important role in activating store-operated Ca2+ channels (SOC) in human mesangial cells
12351446 Alpha-tocopherol decreases superoxide anion release in human monocytes under hyperglycemic conditions via inhibition of protein kinase C-alpha.
12269829 Cis activation of the basal promoter of the PKC alpha gene occurs through an activator protein-2-dependent, phorbol ester-responsive pathway, which suggests an autoregulatory manner of transcription in glioblastoma multiforme cells.
12173071 A294G mutation of protein kinase C alpha does not detectably affect its biochemical properties in vitro or in vivo, and is at least rare in thyroid neoplasias
12097375 PKC alpha functions as a negative modulator of calcineurin-regulated retinoid X receptor responsive element-dependent transcription during T cell activation.
12093536 REVIEW:Interaction of protein kinase C isozymes with membranes containing anionic phospholipids utilizing fluorescent phorbol esters to probe the properties of the C1 domains
12064599 Data show that protein kinase Calpha mediates the effect of antiarrhythmic peptide on gap junction conductance.
12056906 PKC alpha expressed in human neutrophils can phosphorylate p47phox and induce both its translocation and NADPH oxidase activation as well as the binding of p47phox to the cytosolic fragment of p22phox.
11919157 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
11864971 Calcium-dependent involucrin expression is inversely regulated by protein kinase C (PKC)alpha and PKCdelta.
11836255 role in induction of metallproteinases 1 and 3 in fibroblasts by basic calcium phosphate crystals
11833470 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
11805101 the first report of focal adhesion kinase and phosphatidylinositol 3-kinase-dependent PKC-alpha activation in bacterial invasion related to cytoskeletal reorganization
11751262 PKCalpha is required for ET-1-induced human myometrial cell growth
11744714 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
11740573 Isoforms of protein kinase C and their distribution in human adrenal cortex and tumors
11705379 Four residues located near the calcium binding site of PKC alpha are critical for activation and in vivo membrane translocation of the enzyme.
11688977 activation required for vitamin C-succinate induced apoptosis of HL-60 cells
11504923 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
11312657 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
11154208 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
11141237 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
11044099 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
10843712 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
10641798 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
10491200 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
9671211 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
9446795 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
9341215 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
9151826 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
9139671 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
9049329 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
9032396 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
8914829 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
8627654 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
8599832 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
8473314 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
8206685 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
8178481 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
7876252 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
7850771 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
7642615 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
7540194 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
3259291 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
2182321 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
2139676 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
1970444 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
1832084 The gene expression of protein kinase C alpha subunit is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells

AA Sequence

MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVC      1 - 70
CFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVH     71 - 140
KQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQ    141 - 210
KTKTIRSTLNPQWNESFTFKLKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQ    211 - 280
EEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSF    281 - 350
GKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV    351 - 420
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMM    421 - 490
DGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKS    491 - 560
LSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFF    561 - 630
TRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV                                631 - 672
//

Text Mined References (692)

PMID Year Title
26826385 2016 Cobalt chloride-mediated protein kinase C? (PKC?) phosphorylation induces hypoxia-inducible factor 1? (HIF1?) in the nucleus of gastric cancer cell.
26769967 2016 Protein Kinase C? (PKC?) Is Resistant to Long Term Desensitization/Down-regulation by Prolonged Diacylglycerol Stimulation.
26676968 2016 Pigment-Synthesizing Melanocytic Neoplasm With Protein Kinase C Alpha (PRKCA) Fusion.
26671581 2015 Papillary glioneuronal tumors: histological and molecular characteristics and diagnostic value of SLC44A1-PRKCA fusion.
26662512 2016 The GPSM2/LGN GoLoco motifs are essential for hearing.
26657401 2015 Protein Kinase C-Independent Inhibition of Organic Cation Transporter 1 Activity by the Bisindolylmaleimide Ro 31-8220.
26542395 2016 PKC? regulates TMEM16A-mediated Cl? secretion in human biliary cells.
26398575 2015 Protein kinase C?-mediated cytotoxic activity of ineupatorolide B from Inula cappa DC. in HeLa cells.
26350262 2016 PKC? Attenuates Jagged-1-Mediated Notch Signaling in ErbB-2-Positive Breast Cancer to Reverse Trastuzumab Resistance.
26304124 2015 Saturated fatty acids induce post-transcriptional regulation of HAMP mRNA via AU-rich element-binding protein, human antigen R (HuR).
26300055 2015 PKC-?/PKC-? activity balance regulates the lethal effects of cisplatin.
26277396 2015 Isoform-specific dynamic translocation of PKC by ?1-adrenoceptor stimulation in live cells.
26256210 2015 Formin-like 2 Promotes ?1-Integrin Trafficking and Invasive Motility Downstream of PKC?.
26234676 2016 TRM6/61 connects PKC? with translational control through tRNAi(Met) stabilization: impact on tumorigenesis.
26160374 2015 Syndecan-4 Promotes Epithelial Tumor Cells Spreading and Regulates the Turnover of PKC? Activity under Mechanical Stimulation on the Elastomeric Substrates.
26092940 2015 Phosphorylation of PACSIN2 by protein kinase C triggers the removal of caveolae from the plasma membrane.
26063340 2015 P2Y2 nucleotide receptor-mediated extracellular signal-regulated kinases and protein kinase C activation induces the invasion of highly metastatic breast cancer cells.
26056003 2015 PKC? promotes generation of reactive oxygen species via DUOX2 in hepatocellular carcinoma.
26044736 2015 Aurora kinases are essential for PKC-induced invasion and matrix metalloproteinase-9 expression in MCF-7 breast cancer cells.
26033110 2015 Possible role of cortactin phosphorylation by protein kinase C? in actin-bundle formation at growth cone.
26010542 2015 MZF-1/Elk-1 Complex Binds to Protein Kinase C? Promoter and Is Involved in Hepatocellular Carcinoma.
26009271 2015 Protein kinase C affects the internalization and recycling of organic anion transporting polypeptide 1B1.
26009201 2015 Protein kinase C-dependent regulation of connexin43 gap junctions and hemichannels.
25924946 2015 PKC? promotes the mesenchymal to amoeboid transition and increases cancer cell invasiveness.
25752336 2015 Reduction of protein kinase C ? (PKC-?) promote apoptosis via down-regulation of Dicer in bladder cancer.
25724832 2015 Protein kinase C? mediates erlotinib resistance in lung cancer cells.
25693686 2015 Effects of azidothymidine on protein kinase C activity and expression in erythroleukemic cell K562 and acute lymphoblastic leukemia cell HSB-2.
25691573 2015 Glucose deprivation triggers protein kinase C-dependent ?-catenin proteasomal degradation.
25687755 2015 Protein kinase c? regulates the expression of complement receptor Ig in human monocyte-derived macrophages.
25675530 2015 Autism-associated mutation inhibits protein kinase C-mediated neuroligin-4X enhancement of excitatory synapses.
25646356 2015 The predictive value and potential mechanisms of miRNA-328 and miRNA-378 for brain metastases in operable and advanced non-small-cell lung cancer.
25514083 2015 PKC? and PKC? activation regulates transcriptional activity and degradation of progesterone receptor in human astrocytoma cells.
25483185 2014 Induction of mitotic catastrophe by PKC inhibition in Nf1-deficient cells.
25429624 2014 SAP97-mediated ADAM10 trafficking from Golgi outposts depends on PKC phosphorylation.
25391900 2015 PKC-? contributes to high NaCl-induced activation of NFAT5 (TonEBP/OREBP) through MAPK ERK1/2.
25362646 2014 A novel DAG-dependent mechanism links PKC? and Cyclin B1 regulating cell cycle progression.
25313067 2014 Angiotensin II signaling via protein kinase C phosphorylates Kelch-like 3, preventing WNK4 degradation.
25248616 2014 INPP4B suppresses prostate cancer cell invasion.
25233429 2014 Role of calcium in membrane interactions by PI(4,5)P?-binding proteins.
25225290 2014 A kinase inhibitor screen reveals protein kinase C-dependent endocytic recycling of ErbB2 in breast cancer cells.
25138157 2014 Melanoma upregulates ICAM-1 expression on endothelial cells through engagement of tumor CD44 with endothelial E-selectin and activation of a PKC?-p38-SP-1 pathway.
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
25124796 2014 Snail regulated by PKC/GSK-3? pathway is crucial for EGF-induced epithelial-mesenchymal transition (EMT) of cancer cells.
25124035 2014 Systematic analysis of bacterial effector-postsynaptic density 95/disc large/zonula occludens-1 (PDZ) domain interactions demonstrates Shigella OspE protein promotes protein kinase C activation via PDLIM proteins.
25122662 2015 Genomic analysis of fibrolamellar hepatocellular carcinoma.
25080502 2014 Functional variations modulating PRKCA expression and alternative splicing predispose to multiple sclerosis.
25058461 2014 Interaction of PKC? with the armadillo repeats facilitates the N-terminal phosphorylation of ?-catenin.
25026300 2014 Low PKC? expression within the MRD-HR stratum defines a new subgroup of childhood T-ALL with very poor outcome.
24952745 2014 Genetic association study of QT interval highlights role for calcium signaling pathways in myocardial repolarization.
24928086 2014 Role of LPAR3, PKC and EGFR in LPA-induced cell migration in oral squamous carcinoma cells.
24925028 2014 MicroRNA-200b targets protein kinase C? and suppresses triple-negative breast cancer metastasis.
24898696 2014 Wnt5a promotes vasculogenic mimicry and epithelial-mesenchymal transition via protein kinase C? in epithelial ovarian cancer.
24842701 2014 PRKCA polymorphism changes the neural basis of episodic remembering in healthy individuals.
24841200 2014 MicroRNA-200b suppresses arsenic-transformed cell migration by targeting protein kinase C? and Wnt5b-protein kinase C? positive feedback loop and inhibiting Rac1 activation.
24790081 2014 Conserved modular domains team up to latch-open active protein kinase C?.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24632200 2014 Molecular interplays involved in the cellular uptake of octaarginine on cell surfaces and the importance of syndecan-4 cytoplasmic V domain for the activation of protein kinase C?.
24583280 2014 The role of anti-apoptotic protein kinase C? in response to hypericin photodynamic therapy in U-87 MG cells.
24574051 2014 Phosphorylation of ?-tubulin by protein kinase C stimulates microtubule dynamics in human breast cells.
24560667 2014 PKA turnover by the REG?-proteasome modulates FoxO1 cellular activity and VEGF-induced angiogenesis.
24559055 2014 Single-molecule studies reveal a hidden key step in the activation mechanism of membrane-bound protein kinase C-?.
24528886 2014 PKC ? regulates netrin-1/UNC5B-mediated survival pathway in bladder cancer.
24510606 2015 Two novel PRKCI polymorphisms and prostate cancer risk in an Eastern Chinese Han population.
24505490 2014 Regulation of NADPH oxidase 5 by protein kinase C isoforms.
24410631 2014 Protein kinase C-induced early growth response protein-1 binding to SNAIL promoter in epithelial-mesenchymal transition of human embryonic stem cells.
24401212 2014 Hydroxytyrosol suppresses MMP-9 and COX-2 activity and expression in activated human monocytes via PKC? and PKC?1 inhibition.
24366551 2014 Protein kinase C-? downregulates estrogen receptor-? by suppressing c-Jun phosphorylation in estrogen receptor-positive breast cancer cells.
24336654 2014 Intracellular Ca2+ oscillations generated via the Ca2+-sensing receptor are mediated by negative feedback by PKC? at Thr888.
24316392 2014 A new PKC?/?/TBX3/E-cadherin pathway is involved in PLC?-regulated invasion and migration in human bladder cancer cells.
24297175 2014 Differential protein kinase C-dependent modulation of Kv7.4 and Kv7.5 subunits of vascular Kv7 channels.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24225947 2014 Protein phosphatase 2A is regulated by protein kinase C? (PKC?)-dependent phosphorylation of its targeting subunit B56? at Ser41.
24219286 2013 Elevation of protein kinase C? stimulates osteogenic differentiation of mesenchymal stem cells through the TAT-mediated protein transduction system.
24040137 2013 miR-203 inhibits cell proliferation and migration of lung cancer cells by targeting PKC?.
24029232 2013 Protein kinase C ? is a central signaling node and therapeutic target for breast cancer stem cells.
23990668 2013 Unraveling the role of KIAA1199, a novel endoplasmic reticulum protein, in cancer cell migration.
23977398 2013 PKC activation in Niemann pick C1 cells restores subcellular cholesterol transport.
23977066 2013 Differential regulation of cysteinyl leukotriene receptor signaling by protein kinase C in human mast cells.
23900841 2013 Heat shock proteins regulate activation-induced proteasomal degradation of the mature phosphorylated form of protein kinase C.
23893289 2013 The NTPase/helicase domain of hepatitis C virus nonstructural protein 3 inhibits protein kinase C independently of its NTPase activity.
23887639 2013 Sirolimus-FKBP12.6 impairs endothelial barrier function through protein kinase C-? activation and disruption of the p120-vascular endothelial cadherin interaction.
23882690 2013 Role of PKC? activation of Src, PI-3K/AKT, and ERK in EGF-stimulated proliferation of rat and human conjunctival goblet cells.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23844163 2013 Interleukin-6 expression under gravitational stress due to vibration and hypergravity in follicular thyroid cancer cells.
23838138 2013 Serum protein kinase C? as a diagnostic biomarker of cancers.
23824807 2013 Cell susceptibility to baculovirus transduction and echovirus infection is modified by protein kinase C phosphorylation and vimentin organization.
23754287 2013 Signaling to extracellular signal-regulated kinase from ErbB1 kinase and protein kinase C: feedback, heterogeneity, and gating.
23726511 2013 Genome-wide association study identifies new susceptibility loci for posttraumatic stress disorder.
23680674 2013 Lung inflammation caused by adenosine-5'-triphosphate is mediated via Ca2+/PKCs-dependent COX-2/PGE2 induction.
23629676 2013 Oxidative stress mediates the disruption of airway epithelial tight junctions through a TRPM2-PLC?1-PKC? signaling pathway.
23589289 2013 Electrostatic and hydrophobic interactions differentially tune membrane binding kinetics of the C2 domain of protein kinase C?.
23536578 2013 Nanog expression is negatively regulated by protein kinase C activities in human cancer cell lines.
23526078 2013 PKC? is involved in the progression of kidney carcinoma through regulating netrin-1/UNC5B signaling pathway.
23525101 2013 The syndecan-4/protein kinase C? pathway mediates prostaglandin E2-induced extracellular regulated kinase (ERK) activation in endothelial cells and angiogenesis in vivo.
23524339 2013 PKC mediates fluctuant ERK-paxillin signaling for hepatocyte growth factor-induced migration of hepatoma cell HepG2.
23508961 2013 Agonist-induced down-regulation of endogenous protein kinase c ? through an endolysosomal mechanism.
23468872 2013 Clinicopathological correlation and prognostic significance of protein kinase c? overexpression in human gastric carcinoma.
23401860 2013 Monoubiquitination of filamin B regulates vascular endothelial growth factor-mediated trafficking of histone deacetylase 7.
23393340 2013 Kinase activity of protein kinase c? in serum as a diagnostic biomarker of human lung cancer.
23389293 2013 Protein kinase C? inhibitor protects against downregulation of claudin-1 during epithelial-mesenchymal transition of pancreatic cancer.
23349388 2013 Erythrocyte NADPH oxidase activity modulated by Rac GTPases, PKC, and plasma cytokines contributes to oxidative stress in sickle cell disease.
23288845 2013 Protein kinase C controls vesicular transport and secretion of apolipoprotein E from primary human macrophages.
23201854 2013 Involvement of protein kinase C in C5a-primed neutrophils for ANCA-mediated activation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23114726 2013 Suppression of 12-O-tetradecanoylphorbol-13-acetate-induced MCF-7 breast adenocarcinoma cells invasion/migration by ?-tomatine through activating PKC?/ERK/NF-?B-dependent MMP-2/MMP-9 expressions.
23098446 2012 Modulation of drug resistance in ovarian cancer cells by inhibition of protein kinase C-alpha (PKC-?) with small interference RNA (siRNA) agents.
23070544 2012 TNF-? up-regulates protein level and cell surface expression of the leptin receptor by stimulating its export via a PKC-dependent mechanism.
23066026 2012 The Src family kinases and protein kinase C synergize to mediate Gq-dependent platelet activation.
22969158 2012 Network analysis of the focal adhesion to invadopodia transition identifies a PI3K-PKC? invasive signaling axis.
22919060 2012 Cross talk between PKC and CREB in the induction of COX-2 by PGF2? in human amnion fibroblasts.
22898813 2012 Cryptococcus neoformans activates RhoGTPase proteins followed by protein kinase C, focal adhesion kinase, and ezrin to promote traversal across the blood-brain barrier.
22872490 2013 Isoform ? of PKC may contribute to the maintenance of pregnancy myometrial quiescence in humans.
22865467 2012 EGFR and PKC are involved in the activation of ERK1/2 and p90 RSK and the subsequent proliferation of SNU-407 colon cancer cells by muscarinic acetylcholine receptors.
22815910 2012 Vitamin E isoforms differentially regulate intercellular adhesion molecule-1 activation of PKC? in human microvascular endothelial cells.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22797061 2013 Annexin A6 is a scaffold for PKC? to promote EGFR inactivation.
22773839 2012 Protein kinase C? (PKC?) regulates p53 localization and melanoma cell survival downstream of integrin ?v in three-dimensional collagen and in vivo.
22732145 2012 Diacylglycerol kinase ? counteracts protein kinase C-mediated inactivation of the EGF receptor.
22685300 2012 Phosphorylation of adaptor protein containing pleckstrin homology domain, phosphotyrosine binding domain, and leucine zipper motif 1 (APPL1) at Ser430 mediates endoplasmic reticulum (ER) stress-induced insulin resistance in hepatocytes.
22670899 2012 Spatiotemporal regulation of PKC via interactions with AKAP7 isoforms.
22653970 2012 Long QT2 mutation on the Kv11.1 ion channel inhibits current activity by ablating a protein kinase C? consensus site.
22639047 2012 Protein kinase C? protects against multidrug resistance in human colon cancer cells.
22617682 2012 Autocrine CCL2 promotes cell migration and invasion via PKC activation and tyrosine phosphorylation of paxillin in bladder cancer cells.
22586106 2012 PKC? is genetically linked to memory capacity in healthy subjects and to risk for posttraumatic stress disorder in genocide survivors.
22582175 2012 Protein kinase C-? and arginase I mediate pneumolysin-induced pulmonary endothelial hyperpermeability.
22559731 2012 Expression of protein kinase C? and the MZF-1 and elk-1 transcription factors in human bladder transitional cell carcinoma cells.
22537850 2012 Protein kinase C stimulates human B cell activating factor gene expression through reactive oxygen species-dependent c-Fos in THP-1 pro-monocytic cells.
22536444 2012 PKC? binds G3BP2 and regulates stress granule formation following cellular stress.
22532564 2012 Protein kinase C? and Src kinase support human prostate-distributed dihydrotestosterone-metabolizing UDP-glucuronosyltransferase 2B15 activity.
22532149 2012 Increased apoptosis in human knee osteoarthritis cartilage related to the expression of protein kinase B and protein kinase Cα in chondrocytes.
22475757 2012 Protein kinase C isoforms have differential roles in the regulation of human sebocyte biology.
22469974 2013 PKC? phosphorylation of RhoGDI2 at Ser31 disrupts interactions with Rac1 and decreases GDI activity.
22407785 2012 Direct evidence that PKC? positively regulates wound re-epithelialization: correlation with changes in desmosomal adhesiveness.
22393054 2012 Phosphorylation by protein kinase C? regulates RalB small GTPase protein activation, subcellular localization, and effector utilization.
22247259 2012 CD36 ectodomain phosphorylation blocks thrombospondin-1 binding: structure-function relationships and regulation by protein kinase C.
22242955 2012 Expression of protein kinase C isoforms in cancerous breast tissue and adjacent normal breast tissue.
22242952 2012 Expression of protein kinase C ? and the MZF-1 and Elk-1 transcription factors in human breast cancer cells.
22031842 2011 Mechanisms for vascular cell adhesion molecule-1 activation of ERK1/2 during leukocyte transendothelial migration.
22027822 2011 Protein kinase C? promotes cell migration through a PDZ-dependent interaction with its novel substrate discs large homolog 1 (DLG1).
22021425 2012 Genome-wide association study of body height in African Americans: the Women's Health Initiative SNP Health Association Resource (SHARe).
21957166 2011 Protein kinase C? activity is important for contraction-induced FXYD1 phosphorylation in skeletal muscle.
21952047 2011 PKC alpha regulates Sendai virus-mediated interferon induction through HDAC6 and ?-catenin.
21903576 2011 Control of protein kinase C activity, phorbol ester-induced cytoskeletal remodeling, and cell survival signals by the scaffolding protein SSeCKS/GRAVIN/AKAP12.
21895402 2011 Over-expression of protein kinase C?isoforms (?, ?, ? and ?) in squamous cervical cancer.
21873429 2011 Ca2+ influx through reverse mode Na+/Ca2+ exchange is critical for vascular endothelial growth factor-mediated extracellular signal-regulated kinase (ERK) 1/2 activation and angiogenic functions of human endothelial cells.
21840882 2011 Tauroursodeoxycholate (TUDCA) inhibits neointimal hyperplasia by suppression of ERK via PKC?-mediated MKP-1 induction.
21829170 2011 Regulation of glycine receptor diffusion properties and gephyrin interactions by protein kinase C.
21825068 2011 Host cytosolic phospholipase A?? contributes to group B Streptococcus penetration of the blood-brain barrier.
21741352 2011 Curcumin modulates PKC? activity by a membrane-dependent effect.
21735098 2011 PKC? take part in CCR7/NF-?B autocrine signaling loop in CCR7-positive squamous cell carcinoma of head and neck.
21720730 2011 Protein kinase C? suppresses the expression of STC1 in MDA-MB-231 breast cancer cells.
21712053 2011 Protein kinase C ? regulates nuclear pri-microRNA 15a release as part of endothelin signaling.
21705328 2011 Dual function of protein kinase C (PKC) in 12-O-tetradecanoylphorbol-13-acetate (TPA)-induced manganese superoxide dismutase (MnSOD) expression: activation of CREB and FOXO3a by PKC-alpha phosphorylation and by PKC-mediated inactivation of Akt, respectively.
21703451 2011 The INAD scaffold is a dynamic, redox-regulated modulator of signaling in the Drosophila eye.
21658388 2011 Inhibitory mechanism of pure curcumin on Wilms' tumor 1 (WT1) gene expression through the PKC? signaling pathway in leukemic K562 cells.
21576361 2011 Phosphorylation of eukaryotic translation initiation factor 4G1 (eIF4G1) by protein kinase C{alpha} regulates eIF4G1 binding to Mnk1.
21482705 2011 Btk regulation in human and mouse B cells via protein kinase C phosphorylation of IBtk?.
21474332 2011 The vanilloid capsaicin induces IL-6 secretion in prostate PC-3 cancer cells.
21448905 2011 MicroRNA-328 is associated with (non-small) cell lung cancer (NSCLC) brain metastasis and mediates NSCLC migration.
21389833 2011 VEGFR1 and PKC? signaling control melanoma vasculogenic mimicry in a VEGFR2 kinase-independent manner.
21386996 2011 PKC? and PKC? regulate ADAM17-mediated ectodomain shedding of heparin binding-EGF through separate pathways.
21354279 2011 Suppression of phorbol-12-myristate-13-acetate-induced tumor cell invasion by piperine via the inhibition of PKC?/ERK1/2-dependent matrix metalloproteinase-9 expression.
21323641 2011 Epithelial-mesenchymal transdifferentiation of renal tubular epithelial cells induced by urinary proteins requires the activation of PKC-? and ?I isozymes.
21321125 2011 PKC alpha mediates beta-arrestin2-dependent nephrin endocytosis in hyperglycemia.
21269460 2011 Initial characterization of the human central proteome.
21156808 2011 The calcium ATPase SERCA2 regulates desmoplakin dynamics and intercellular adhesive strength through modulation of PKCα signaling.
21113078 2011 Nuclear localization of phospholipase D1 mediates the activation of nuclear protein kinase C(alpha) and extracellular signal-regulated kinase signaling pathways.
21106355 2012 PKC? inhibited apoptosis by decreasing the activity of JNK in MCF-7/ADR cells.
21090097 2010 [Effect of topical corticosteroids on expression of PKC, Bcl-2 and Bax in nasal polyps].
20940303 2010 Protein kinase C phosphorylation regulates membrane insertion of GABAA receptor subtypes that mediate tonic inhibition.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
20819076 2010 Interaction with receptor for activated C-kinase 1 (RACK1) sensitizes the phosphodiesterase PDE4D5 towards hydrolysis of cAMP and activation by protein kinase C.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20815813 2010 Regulation of the tumour suppressor Fbw7? by PKC-dependent phosphorylation and cancer-associated mutations.
20691662 2010 TCR-induced Akt serine 473 phosphorylation is regulated by protein kinase C-alpha.
20689063 2010 Receptor-independent cardiac protein kinase Calpha activation by calpain-mediated truncation of regulatory domains.
20673527 2010 [The clinical signifcance of expression of ERCC1 and PkCalpha in non-small cell lung cancer].
20618341 2010 Triggering Ras signalling by intracellular Francisella tularensis through recruitment of PKC? and ?I to the SOS2/GrB2 complex is essential for bacterial proliferation in the cytosol.
20513439 2010 Erk1/2-dependent phosphorylation of PKCalpha at threonine 638 in hippocampal 5-HT(1A) receptor-mediated signaling.
20506636 2010 [Protein kinase C activation is required for free fatty acid-induced impairment of endothelial nitric oxide synthase].
20486122 2010 Quantitative proteome analysis of detergent-resistant membranes identifies the differential regulation of protein kinase C isoforms in apoptotic T cells.
20458747 2010 12-O-tetradecanoylphorbol-13-acetate-induced invasion/migration of glioblastoma cells through activating PKCalpha/ERK/NF-kappaB-dependent MMP-9 expression.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20444294 2010 PKCalpha mediated induction of miR-101 in human hepatoma HepG2 cells.
20430034 2010 Regulation of arginine transport and metabolism by protein kinase Calpha in endothelial cells: stimulation of CAT2 transporters and arginase activity.
20426528 2010 Up-regulation of cyclin D1 expression in asthma serum-sensitized human airway smooth muscle promotes proliferation via protein kinase C alpha.
20422977 2010 [Expression and significance of IGF-IR and PKC in laryngeal squamous cell carcinoma].
20419132 2010 Podocytic PKC-alpha is regulated in murine and human diabetes and mediates nephrin endocytosis.
20407865 2010 Changes of protein kinase Calpha and cyclin D1 expressions in pulmonary arteries from smokers with and without chronic obstructive pulmonary disease.
20398285 2010 PKCalpha expression is a marker for breast cancer aggressiveness.
20385812 2010 Dual role of protein kinase C on BK channel regulation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20350647 2010 Evidence of a gene-environment interaction that predisposes to spontaneous preterm birth: a role for asymptomatic bacterial vaginosis and DNA variants in genes that control the inflammatory response.
20346360 2010 Genetic risk factors for hepatopulmonary syndrome in patients with advanced liver disease.
20333651 2010 TNF-alpha induces matrix metalloproteinase-9 expression in A549 cells: role of TNFR1/TRAF2/PKCalpha-dependent signaling pathways.
20228790 2010 Phosphorylation of histone H3T6 by PKCbeta(I) controls demethylation at histone H3K4.
20216103 2010 RNAi-mediated knockdown of protein kinase C-alpha inhibits cell migration in MM-RU human metastatic melanoma cell line.
20149875 2010 The effects of PKCalpha phosphorylation on the extensibility of titin's PEVK element.
20145126 2010 Activation of the integrin effector kinase focal adhesion kinase in cancer cells is regulated by crosstalk between protein kinase Calpha and the PDZ adapter protein mda-9/Syntenin.
20141446 2010 Am80 inhibits stromal cell-derived factor-1-induced chemotaxis in T-cell acute lymphoblastic leukemia cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20056645 2010 Association of mitotic regulation pathway polymorphisms with pancreatic cancer risk and outcome.
20032081 2010 PPARgamma agonists inhibit angiogenesis by suppressing PKCalpha- and CREB-mediated COX-2 expression in the human endothelium.
20030858 2009 Downregulation of protein kinase C-alpha enhances intracellular survival of Mycobacteria: role of PknG.
20011604 2009 A phosphoinositide 3-kinase/phospholipase Cgamma1 pathway regulates fibroblast growth factor-induced capillary tube formation.
20011080 2009 PKC alpha affects cell cycle progression and proliferation in human RPE cells through the downregulation of p27kip1.
19969380 2010 Protein kinase Calpha: disease regulator and therapeutic target.
19950169 2010 PKC-alpha controls MYD88-dependent TLR/IL-1R signaling and cytokine production in mouse and human dendritic cells.
19895572 2010 Conventional protein kinase C plays a critical role in negative regulation of CD98-induced homotypic aggregation.
19855090 2009 The IGF-I receptor can alter the matrix metalloproteinase repertoire of tumor cells through transcriptional regulation of PKC-{alpha}.
19827831 2009 Discovery of 3-(1H-indol-3-yl)-4-[2-(4-methylpiperazin-1-yl)quinazolin-4-yl]pyrrole-2,5-dione (AEB071), a potent and selective inhibitor of protein kinase C isotypes.
19825989 2009 H3 histamine receptor-mediated activation of protein kinase Calpha inhibits the growth of cholangiocarcinoma in vitro and in vivo.
19801684 2009 Reactive oxygen species-generating mitochondrial DNA mutation up-regulates hypoxia-inducible factor-1alpha gene transcription via phosphatidylinositol 3-kinase-Akt/protein kinase C/histone deacetylase pathway.
19794964 2009 Tumor-endothelium cross talk blocks recruitment of neutrophils to endothelial cells: a novel mechanism of endothelial cell anergy.
19786960 2010 Evidence for rare and common genetic risk variants for schizophrenia at protein kinase C, alpha.
19712589 2009 SH2D4A regulates cell proliferation via the ERalpha/PLC-gamma/PKC pathway.
19698232 2009 [Effects of protein kinase C activity on CD44 expression and subcellular distribution in human erythrocytes].
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19681907 2009 Cell invasion of Yersinia pseudotuberculosis by invasin and YadA requires protein kinase C, phospholipase C-gamma1 and Akt kinase.
19672862 2009 Protein kinase C alpha-dependent signaling mediates endometrial cancer cell growth and tumorigenesis.
19655190 2010 Protein kinase C alpha and epsilon phosphorylation of troponin and myosin binding protein C reduce Ca2+ sensitivity in human myocardium.
19639961 2009 Regulation of folate receptor internalization by protein kinase C alpha.
19635931 2010 Sequential activation of protein kinase C isoforms by organic dust is mediated by tumor necrosis factor.
19626679 2009 Negative regulation of endogenous protein kinase Calpha on the dynamic change of carbachol-induced intracellular calcium response in different melanoma cells.
19609943 2010 Caveolin-1 promotes resistance to chemotherapy-induced apoptosis in Ewing's sarcoma cells by modulating PKCalpha phosphorylation.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19592459 2009 Mutation of protein kinase C phosphorylation site S1076 on alpha-subunits affects BK(Ca) channel activity in HEK-293 cells.
19576566 2009 PRKCA: a positional candidate gene for body mass index and asthma.
19523156 2009 Phosphorylation of the influenza A virus protein PB1-F2 by PKC is crucial for apoptosis promoting functions in monocytes.
19509063 2009 A new mechanism of SOX9 action to regulate PKCalpha expression in the intestine epithelium.
19459855 2009 Protein kinase Calpha-responsive polymeric carrier: its application for gene delivery into human cancers.
19449091 2009 LeY oligosaccharide upregulates DAG/PKC signaling pathway in the human endometrial cells.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19357285 2009 ADAM-10-mediated N-cadherin cleavage is protein kinase C-alpha dependent and promotes glioblastoma cell migration.
19340015 2009 Role for protein kinase C-alpha in keratinocyte growth arrest.
19324950 2009 PKC(alpha) and PKC(epsilon) differentially regulate Legionella pneumophila-induced GM-CSF.
19324870 2009 Common polymorphism in the phosphatase PHLPP2 results in reduced regulation of Akt and protein kinase C.
19291828 2009 Antisense expression of PKCalpha improved sensitivity of SGC7901/VCR cells to doxorubicin.
19281832 2009 Activation of ROS/NF-kappaB and Ca2+/CaM kinase II are necessary for VCAM-1 induction in IL-1beta-treated human tracheal smooth muscle cells.
19235902 2009 Protein kinase C alpha (PKCalpha) regulates growth and invasion of endometrial cancer cells.
19176525 2009 Phosphorylation of Activation Transcription Factor-2 at Serine 121 by Protein Kinase C Controls c-Jun-mediated Activation of Transcription.
19176518 2009 EGFR signals to mTOR through PKC and independently of Akt in glioma.
19158275 2009 Protein kinase C-dependent phosphorylation regulates the cell cycle-inhibitory function of the p73 carboxy terminus transactivation domain.
19116345 2009 Sphingosine kinase as an oncogene: autocrine sphingosine 1-phosphate modulates ML-1 thyroid carcinoma cell migration by a mechanism dependent on protein kinase C-alpha and ERK1/2.
19097143 2009 IL-1 beta induces urokinase-plasminogen activator expression and cell migration through PKC alpha, JNK1/2, and NF-kappaB in A549 cells.
19088254 2009 Regulation of human organic anion transporter 1 by ANG II: involvement of protein kinase Calpha.
19087983 2009 Role of protein kinase Calpha in regulation of [Ca2+](I) and force in human myometrium.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
19073232 2009 Endothelial factors mediate aldosterone release via PKA-independent pathways.
19060919 2009 The actin-cytoskeleton linker protein ezrin is regulated during osteosarcoma metastasis by PKC.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19056838 2009 Investigation of the marine compound spongistatin 1 links the inhibition of PKCalpha translocation to nonmitotic effects of tubulin antagonism in angiogenesis.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
19029835 2009 PKCalpha activation downregulates ATM and radio-sensitizes androgen-sensitive human prostate cancer cells in vitro and in vivo.
18991684 2008 Post-transcriptional regulation of HSP70 expression following oxidative stress in SH-SY5Y cells: the potential involvement of the RNA-binding protein HuR.
18983267 2009 PI3Kgamma controls oxidative bursts in neutrophils via interactions with PKCalpha and p47phox.
18950621 2009 PDGF receptor activation induces p120-catenin phosphorylation at serine 879 via a PKCalpha-dependent pathway.
18755856 2008 Phosphorylation of farnesoid X receptor by protein kinase C promotes its transcriptional activity.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18637128 2009 Protein kinase C isoenzymes differentially regulate the differentiation-dependent expression of adhesion molecules in human epidermal keratinocytes.
18622039 2008 Phosphorylation of endothelial nitric-oxide synthase regulates superoxide generation from the enzyme.
18566587 2008 Essential function of TORC2 in PKC and Akt turn motif phosphorylation, maturation and signalling.
18566014 2008 Toll-like receptor 3 triggers apoptosis of human prostate cancer cells through a PKC-alpha-dependent mechanism.
18556656 2008 The major chemical-detoxifying system of UDP-glucuronosyltransferases requires regulated phosphorylation supported by protein kinase C.
18534651 2008 Membrane ERalpha-dependent activation of PKCalpha in endometrial cancer cells by estradiol.
18503554 2008 Heat-induced MMP-1 expression is mediated by TRPV1 through PKCalpha signaling in HaCaT cells.
18489726 2008 Invasion of Cryptococcus neoformans into human brain microvascular endothelial cells requires protein kinase C-alpha activation.
18474624 2008 Plakophilin 2: a critical scaffold for PKC alpha that regulates intercellular junction assembly.
18434368 2008 IGF-II/mannose-6-phosphate receptor signaling induced cell hypertrophy and atrial natriuretic peptide/BNP expression via Galphaq interaction and protein kinase C-alpha/CaMKII activation in H9c2 cardiomyoblast cells.
18401527 2008 Inhibition of fibroblast growth factor 2-induced apoptosis involves survivin expression, protein kinase C alpha activation and subcellular translocation of Smac in human small cell lung cancer cells.
18372343 2008 Protein kinase Calpha-induced derepression of the human luteinizing hormone receptor gene transcription through ERK-mediated release of HDAC1/Sin3A repressor complex from Sp1 sites.
18372238 2008 Protein kinase C alpha modulates liver X receptor alpha transactivation.
18354190 2008 Protein kinase C alpha and zeta differentially regulate death-inducing signaling complex formation in cigarette smoke extract-induced apoptosis.
18314869 2008 Overexpression of protein kinase Calpha mRNA may be an independent prognostic marker for gastric carcinoma.
18292781 2008 NG2, a novel proapoptotic receptor, opposes integrin alpha4 to mediate anoikis through PKCalpha-dependent suppression of FAK phosphorylation.
18281137 2008 Association of missense variants of the PRKC, apoptosis, WT1, regulator (PAWR) gene with schizophrenia.
18239055 2008 TGF-beta mediates PTEN suppression and cell motility through calcium-dependent PKC-alpha activation in pancreatic cancer cells.
18206668 2008 RXR agonists inhibit high-glucose-induced oxidative stress by repressing PKC activity in human endothelial cells.
18184679 2008 Differential regulation of Moraxella catarrhalis-induced interleukin-8 response by protein kinase C isoforms.
18162471 2008 S-Phase-specific activation of PKC alpha induces senescence in non-small cell lung cancer cells.
18089814 2007 Activation of bone morphogenetic protein signaling by a Gemini vitamin D3 analogue is mediated by Ras/protein kinase C alpha.
18088087 2008 Phosphoproteome of resting human platelets.
18056764 2008 Protein kinase C alpha promotes angiogenic activity of human endothelial cells via induction of vascular endothelial growth factor.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17983652 2008 Calcitonin promotes outgrowth of trophoblast cells on endometrial epithelial cells: involvement of calcium mobilization and protein kinase C activation.
17974965 2007 Protein kinase C-alpha-mediated regulation of low-density lipoprotein receptor related protein and urokinase increases astrocytoma invasion.
17951978 2007 Angiotensin II directly triggers endothelial exocytosis via protein kinase C-dependent protein kinase D2 activation.
17936705 2007 Increased steady-state levels of CUGBP1 in myotonic dystrophy 1 are due to PKC-mediated hyperphosphorylation.
17934063 2007 Hog barn dust slows airway epithelial cell migration in vitro through a PKCalpha-dependent mechanism.
17923691 2007 Protein kinase C-dependent control of Bcl-x alternative splicing.
17893151 2007 Amplitude control of protein kinase C by RINCK, a novel E3 ubiquitin ligase.
17828490 2007 The effect of Ginkgo Biloba extract on the expression of PKCalpha in the inflammatory cells and the level of IL-5 in induced sputum of asthmatic patients.
17786270 2007 In vitro evidence of the role of hemoglobin during vasospasm on the modifications of the expression of PKCalpha and zeta.
17724468 2008 Protein kinase C alpha-CARMA3 signaling axis links Ras to NF-kappa B for lysophosphatidic acid-induced urokinase plasminogen activator expression in ovarian cancer cells.
17689692 2007 Protein kinase C alpha modulates microvascular reactivity in the human coronary and skeletal microcirculation.
17666590 2007 Direct binding and activation of protein kinase C isoforms by aldosterone and 17beta-estradiol.
17591920 2007 Differential phosphorylation of NG2 proteoglycan by ERK and PKCalpha helps balance cell proliferation and migration.
17588800 2007 Protein kinase C-alpha antagonizes apoptosis induction by histone deacetylase inhibitors in multidrug resistant leukaemia cells.
17545611 2007 Protein kinase Calpha determines HER2 fate in breast carcinoma cells with HER2 protein overexpression without gene amplification.
17525530 2007 STAT3 and PKC differentially regulate telomerase activity during megakaryocytic differentiation of K562 cells.
17459358 2007 Overexpression of protein kinase C alpha mRNA in human hepatocellular carcinoma: a potential marker of disease prognosis.
17455194 2007 The essentiality of PKCalpha and PKCbetaI translocation for CD14+monocyte differentiation towards macrophages and dendritic cells, respectively.
17438848 2007 [The role of protein kinase C and activator protein-1 signal cascade in the regulation of expression of interleukin-5 in T lymphocyte of allergic rhinitis].
17392515 2007 Protein kinase C alpha-dependent phosphorylation of the mRNA-stabilizing factor HuR: implications for posttranscriptional regulation of cyclooxygenase-2.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17341442 2007 Insulin-like growth factor-I induces cyclooxygenase-2 expression via PI3K, MAPK and PKC signaling pathways in human ovarian cancer cells.
17334233 2007 PMA-induced up-regulation of MMP-9 is regulated by a PKCalpha-NF-kappaB cascade in human lung epithelial cells.
17321722 2007 A PKC-Sp1 signaling pathway induces early differentiation of human keratinocytes through upregulation of TSG101.
17307332 2007 Protein kinase Calpha mediates feedback inhibition of EGF receptor transactivation induced by Gq-coupled receptor agonists.
17255356 2007 The role of PKC and PDK1 in monocyte lineage specification by Ras.
17244820 2007 The A-kinase anchoring protein 15 regulates feedback inhibition of the epithelial Na+ channel.
17212360 2007 Protein kinase Calpha is differentially activated during neonatal and adult erythropoiesis and favors expression of a reporter gene under the control of the (A)gamma globin-promoter in cellular models of hemoglobin switching.
17197445 2007 Galphaq-TRPC6-mediated Ca2+ entry induces RhoA activation and resultant endothelial cell shape change in response to thrombin.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
17171646 2007 Proliferation of human breast cancer cells and anti-cancer action of doxorubicin and vinblastine are independent of PKC-alpha.
17157935 2007 Selective roles for alpha-PKC in positive signaling for O-(2) generation and calcium mobilization but not elastase release in differentiated HL60 cells.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17061041 2007 Protein Kinase C alpha is a marker for antiestrogen resistance and is involved in the growth of tamoxifen resistant human breast cancer cells.
16984735 2006 Neurotensin phosphorylates GSK-3alpha/beta through the activation of PKC in human colon cancer cells.
16979586 2006 Inositol hexaphosphate represses telomerase activity and translocates TERT from the nucleus in mouse and human prostate cancer cells via the deactivation of Akt and PKCalpha.
16964312 2006 CXCR2 ligands and G-CSF mediate PKCalpha-induced intraepidermal inflammation.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16963226 2007 PKCalpha regulates phosphorylation and enzymatic activity of cPLA2 in vitro and in activated human monocytes.
16942862 2007 Differential activation of the PI 3-kinase effectors AKT/PKB and p70 S6 kinase by compound 48/80 is mediated by PKCalpha.
16939222 2006 WISP-2/CCN5 is involved as a novel signaling intermediate in phorbol ester-protein kinase Calpha-mediated breast tumor cell proliferation.
16890208 2006 Mitogenic and drug-resistance mediating effects of PKCalpha require RLIP76.
16836077 2006 [The expressions of protein kinase CK2alpha in squamous cell carcinoma of larynx and its clinical significance].
16775601 2006 Glomerular clusterin is associated with PKC-alpha/beta regulation and good outcome of membranous glomerulonephritis in humans.
16751194 2006 Dynamic sequestration of the recycling compartment by classical protein kinase C.
16710050 2006 Bile acids stimulate PKCalpha autophosphorylation and activation: role in the attenuation of prostaglandin E1-induced cAMP production in human dermal fibroblasts.
16697522 2006 Role of protein kinase Calpha in melatonin signal transduction.
16673150 2006 Insulin inhibits phagocytosis in normal human neutrophils via PKCalpha/beta-dependent priming of F-actin assembly.
16642043 2006 Bcl2 phosphorylation and active PKC alpha are associated with poor survival in AML.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16620963 2006 Tyrosine kinase modulation of protein kinase C activity regulates G protein-linked Ca2+ signaling in leukemic hematopoietic cells.
16571380 2006 Histamine increases sphingosine kinase-1 expression and activity in the human arterial endothelial cell line EA.hy 926 by a PKC-alpha-dependent mechanism.
16517978 2006 Heterogeneity of cellular proliferation within transitional cell carcinoma: correlation of protein kinase C alpha/betaI expression and activity.
16338977 2006 Protein kinase C mediates erythrocyte "programmed cell death" following glucose depletion.
16300929 2006 Caspases 3 and 9 are translocated to the cytoskeleton and activated by thrombin in human platelets. Evidence for the involvement of PKC and the actin filament polymerization.
16297876 2006 PKCalpha expression regulated by Elk-1 and MZF-1 in human HCC cells.
16236797 2006 Specific translocation of protein kinase Calpha to the plasma membrane requires both Ca2+ and PIP2 recognition by its C2 domain.
16129412 2005 Signaling by Kit protein-tyrosine kinase--the stem cell factor receptor.
16099831 2005 Neuronal ELAV proteins enhance mRNA stability by a PKCalpha-dependent pathway.
16087181 2005 The role of PKCalpha and RLIP76 in transport-mediated doxorubicin-resistance in lung cancer.
16081872 2005 PKCalpha activates eNOS and increases arterial blood flow in vivo.
16080189 2005 Genes encoding catalytic subunits of protein kinase A and risk of spina bifida.
16079140 2005 The origin of C1A-C2 interdomain interactions in protein kinase Calpha.
16055064 2005 PICK1 interacts with ABP/GRIP to regulate AMPA receptor trafficking.
16027158 2005 Phosphorylation of coronin 1B by protein kinase C regulates interaction with Arp2/3 and cell motility.
16006559 2005 Protein kinase C-dependent protein kinase D activation modulates ERK signal pathway and endothelial cell proliferation by vascular endothelial growth factor.
15917995 2005 Activation of protein kinase C alpha is required for TPA-triggered ERK (MAPK) signaling and growth inhibition of human hepatoma cell HepG2.
15894802 2005 Protein kinase C phosphorylation of the metabotropic glutamate receptor mGluR5 on Serine 839 regulates Ca2+ oscillations.
15814724 2005 Activation-induced depletion of protein kinase C alpha provokes desensitization of monocytes/macrophages in sepsis.
15757899 2005 Protein kinase C-dependent regulation of NAG-1/placental bone morphogenic protein/MIC-1 expression in LNCaP prostate carcinoma cells.
15691837 2005 Opposing effects of protein kinase Calpha and protein kinase Cepsilon on collagen expression by human lung fibroblasts are mediated via MEK/ERK and caveolin-1 signaling.
15632189 2005 Translocation of diacylglycerol kinase theta from cytosol to plasma membrane in response to activation of G protein-coupled receptors and protein kinase C.
15627650 2005 n-3 PUFAs modulate T-cell activation via protein kinase C-alpha and -epsilon and the NF-kappaB signaling pathway.
15613483 2005 Epidermal and hepatocyte growth factors, but not keratinocyte growth factor, modulate protein kinase Calpha translocation to the plasma membrane through 15(S)-hydroxyeicosatetraenoic acid synthesis.
15603822 2005 Involvement of protein kinase C in chitosan glutamate-mediated tight junction disruption.
15583006 2005 Functional interaction of protein kinase Calpha with the tyrosine kinases Syk and Src in human platelets.
15576373 2005 Protease-activated receptor-1 activation of endothelial cells induces protein kinase Calpha-dependent phosphorylation of syntaxin 4 and Munc18c: role in signaling p-selectin expression.
15572354 2005 Protein kinase C modulates agonist-sensitive release of Ca2+ from internal stores in HEK293 cells overexpressing the calcium sensing receptor.
15564481 2004 Protein kinase C-alpha activity is required for respiratory syncytial virus fusion to human bronchial epithelial cells.
15563462 2005 Transcriptional repression of protein kinase Calpha via Sp1 by wild type p53 is involved in inhibition of multidrug resistance 1 P-glycoprotein phosphorylation.
15555220 2004 Expression levels of protein kinase C-alpha in non-small-cell lung cancer.
15531915 2005 Ets1 is an effector of protein kinase Calpha in cancer cells.
15526160 2004 Signal transduction via the stem cell factor receptor/c-Kit.
15509588 2005 Tumor cell-mediated induction of the stromal factor stromelysin-3 requires heterotypic cell contact-dependent activation of specific protein kinase C isoforms.
15504744 2004 Phosphorylation of NG2 proteoglycan by protein kinase C-alpha regulates polarized membrane distribution and cell motility.
15499829 2004 Effects of the antiandrogen flutamide on the expression of protein kinase C isoenzymes in LNCaP and PC3 human prostate cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15456937 2004 Lithium-mediated phosphorylation of glycogen synthase kinase-3beta involves PI3 kinase-dependent activation of protein kinase C-alpha.
15381704 2004 Protein kinase C isoforms differentially phosphorylate human choline acetyltransferase regulating its catalytic activity.
15284224 2004 Decay-accelerating factor induction on vascular endothelium by vascular endothelial growth factor (VEGF) is mediated via a VEGF receptor-2 (VEGF-R2)- and protein kinase C-alpha/epsilon (PKCalpha/epsilon)-dependent cytoprotective signaling pathway and is inhibited by cyclosporin A.
15277524 2004 Autophosphorylation suppresses whereas kinase inhibition augments the translocation of protein kinase Calpha in response to diacylglycerol.
15272003 2004 Serine and threonine phosphorylation of the low density lipoprotein receptor-related protein by protein kinase Calpha regulates endocytosis and association with adaptor molecules.
15269224 2004 Regulation of SHP-1 tyrosine phosphatase in human platelets by serine phosphorylation at its C terminus.
15247289 2004 The PDZ domain of PICK1 differentially accepts protein kinase C-alpha and GluR2 as interacting ligands.
15233804 2004 Differential involvement of protein kinase C alpha and epsilon in the regulated secretion of soluble amyloid precursor protein.
15228384 2004 The plasma membrane translocation of diacylglycerol kinase delta1 is negatively regulated by conventional protein kinase C-dependent phosphorylation at Ser-22 and Ser-26 within the pleckstrin homology domain.
15221008 2004 The M-CSF receptor substrate and interacting protein FMIP is governed in its subcellular localization by protein kinase C-mediated phosphorylation, and thereby potentiates M-CSF-mediated differentiation.
15192100 2004 The interaction of protein kinase C isozymes alpha, iota, and theta with the cytoplasmic domain of L-selectin is modulated by phosphorylation of the receptor.
15169840 2004 Cytoskeletal restraints regulate homotypic ALCAM-mediated adhesion through PKCalpha independently of Rho-like GTPases.
15159477 2004 Expression of protein kinase C isoforms and interleukin-1beta in myofibrillar myopathy.
15155525 2004 Association of protein kinase C alpha (PRKCA) gene with multiple sclerosis in a UK population.
15134451 2004 NMR and mutagenesis studies on the phosphorylation region of human cardiac troponin I.
15123666 2004 The role of protein kinase D in neurotensin secretion mediated by protein kinase C-alpha/-delta and Rho/Rho kinase.
15121854 2004 Protein kinase C-alpha phosphorylation of specific serines in the connecting segment of the beta 4 integrin regulates the dynamics of type II hemidesmosomes.
15084746 2004 Lactosylceramide recruits PKCalpha/epsilon and phospholipase A2 to stimulate PECAM-1 expression in human monocytes and adhesion to endothelial cells.
15051732 2004 PKCalpha mediates TGFbeta-induced growth inhibition of human keratinocytes via phosphorylation of S100C/A11.
15016832 2004 Protein kinase Calpha phosphorylates the TRPC1 channel and regulates store-operated Ca2+ entry in endothelial cells.
15003508 2004 Association of CPI-17 with protein kinase C and casein kinase I.
14960580 2004 Cell volume regulation in response to hypotonicity is impaired in HeLa cells expressing a protein kinase Calpha mutant lacking kinase activity.
14739142 2004 Salmonella typhimurium SipA-induced neutrophil transepithelial migration: involvement of a PKC-alpha-dependent signal transduction pathway.
14709334 2004 Cooperation between PKC-alpha and PKC-epsilon in the regulation of JNK activation in human lung cancer cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14699138 2004 Ki-1/57 interacts with RACK1 and is a substrate for the phosphorylation by phorbol 12-myristate 13-acetate-activated protein kinase C.
14654844 2003 Protein kinase C switches the Raf kinase inhibitor from Raf-1 to GRK-2.
14636580 2003 PKA, PKC, and the protein phosphatase 2A influence HAND factor function: a mechanism for tissue-specific transcriptional regulation.
14606067 2003 Roles of PLC-gamma2 and PKCalpha in TPA-induced apoptosis of gastric cancer cells.
14596793 2003 Phosphorylation of human cardiac troponin I G203S and K206Q linked to familial hypertrophic cardiomyopathy affects actomyosin interaction in different ways.
14532112 2003 Interaction of fascin and protein kinase Calpha: a novel intersection in cell adhesion and motility.
14527960 2003 cPKC-dependent sequestration of membrane-recycling components in a subset of recycling endosomes.
12972622 2003 Protein kinase Calpha (PKCalpha) acts upstream of PKCtheta to activate IkappaB kinase and NF-kappaB in T lymphocytes.
12960759 2003 Impaired degradation of PKCalpha by proteasome in a cellular model of Huntington's disease.
12958364 2003 Dishevelled 2 recruits beta-arrestin 2 to mediate Wnt5A-stimulated endocytosis of Frizzled 4.
12954613 2003 Activation mechanisms of conventional protein kinase C isoforms are determined by the ligand affinity and conformational flexibility of their C1 domains.
12952980 2003 Apolipoprotein A-I activates protein kinase C alpha signaling to phosphorylate and stabilize ATP binding cassette transporter A1 for the high density lipoprotein assembly.
12950453 2003 Physiological regulation of Munc18/nSec1 phosphorylation on serine-313.
12930825 2003 Phosphorylation of SNAP-23 in activated human platelets.
12919677 2003 The MSP receptor regulates alpha6beta4 and alpha3beta1 integrins via 14-3-3 proteins in keratinocyte migration.
12907651 2003 Loss of protein kinase Calpha expression may enhance the tumorigenic potential of Gli1 in basal cell carcinoma.
12896972 2003 A p53-independent G1 cell cycle checkpoint induced by the suppression of protein kinase C alpha and theta isoforms.
12893243 2003 Centaurin-alpha(1) associates with and is phosphorylated by isoforms of protein kinase C.
12890670 2003 Protein kinase C alpha phosphorylates and negatively regulates diacylglycerol kinase zeta.
12881490 2003 A Ras activation pathway dependent on Syk phosphorylation of protein kinase C.
12878187 2003 Protein kinase Calpha negatively regulates cell spreading and motility in MDA-MB-231 human breast cancer cells downstream of epidermal growth factor receptor.
12843260 2003 Phorbol myristate acetate-dependent interaction of protein kinase Calpha and the neuronal glutamate transporter EAAC1.
12839565 2003 Protein kinase C alpha associates with phospholipase D1 and enhances basal phospholipase D activity in a protein phosphorylation-independent manner in human melanoma cells.
12832403 2003 Identification of a functionally critical protein kinase C phosphorylation residue of cardiac troponin T.
12824193 2003 Protein kinase C promotes apoptosis in LNCaP prostate cancer cells through activation of p38 MAPK and inhibition of the Akt survival pathway.
12805550 2003 Requirement of AMPA receptor GluR2 phosphorylation for cerebellar long-term depression.
12783114 2003 Platelet P-selectin expression: requirement for protein kinase C, but not protein tyrosine kinase or phosphoinositide 3-kinase.
12773393 2003 MSK2 and MSK1 mediate the mitogen- and stress-induced phosphorylation of histone H3 and HMG-14.
12754513 2003 AKAP150 signaling complex promotes suppression of the M-current by muscarinic agonists.
12754211 2003 Protein kinase Calpha-induced p115RhoGEF phosphorylation signals endothelial cytoskeletal rearrangement.
12724315 2003 Direct demonstration of involvement of protein kinase Calpha in the Ca2+-induced platelet aggregation.
12704190 2003 The F-actin cross-linking and focal adhesion protein filamin A is a ligand and in vivo substrate for protein kinase C alpha.
12670483 2003 Novel gene hKCNE4 slows the activation of the KCNQ1 channel.
12665801 2003 Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides.
12652652 2003 Role of protein kinase C alpha in calcium induced keratinocyte differentiation: defective regulation in squamous cell carcinoma.
12647293 2003 Regulation of hematopoietic-specific G-protein Galpha15 and Galpha16 by protein kinase C.
12632071 2003 Protein kinase Calpha regulates Ets1 transcriptional activity in invasive breast cancer cells.
12630910 2003 Post-synaptic density-95 promotes calcium/calmodulin-dependent protein kinase II-mediated Ser847 phosphorylation of neuronal nitric oxide synthase.
12618484 2003 Functional association of cytokine-induced SH2 protein and protein kinase C in activated T cells.
12610653 2003 Role of protein kinase Calpha in the regulated secretion of the amyloid precursor protein.
12609995 2003 Activation of cGMP-dependent protein kinase by protein kinase C.
12586732 2003 Hyperosmolarity and CD95L trigger CD95/EGF receptor association and tyrosine phosphorylation of CD95 as prerequisites for CD95 membrane trafficking and DISC formation.
12571249 2003 Direct binding of syndecan-4 cytoplasmic domain to the catalytic domain of protein kinase C alpha (PKC alpha) increases focal adhesion localization of PKC alpha.
12569090 2003 Phosphorylation of serine 1106 in the catalytic domain of topoisomerase II alpha regulates enzymatic activity and drug sensitivity.
12551925 2003 Activation of Raf-1 signaling by protein kinase C through a mechanism involving Raf kinase inhibitory protein.
12536241 2003 Different regulation of PKC isoenzymes and MAPK by PSK and IL-2 in the proliferative and cytotoxic activities of the NKL human natural killer cell line.
12531893 2003 The molecular basis of differential subcellular localization of C2 domains of protein kinase C-alpha and group IVa cytosolic phospholipase A2.
12519779 2003 Phosphorylation of Munc18 by protein kinase C regulates the kinetics of exocytosis.
12509413 2003 ADAM12/syndecan-4 signaling promotes beta 1 integrin-dependent cell spreading through protein kinase Calpha and RhoA.
12490289 Alterations in skeletal protein, distribution of PKCalpha, and level of phospholipids in erythrocyte membranes of women with primary breast cancer.
12486117 2003 Phosphorylation of 69-kDa choline acetyltransferase at threonine 456 in response to amyloid-beta peptide 1-42.
12482669 2002 Signaling pathways triggered by HIV-1 Tat in human monocytes to induce TNF-alpha.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12459461 2002 Differential phosphorylation of SNAP-25 in vivo by protein kinase C and protein kinase A.
12435334 2002 Activation of Integrin-RACK1/PKCalpha signalling in human articular chondrocyte mechanotransduction.
12431982 2003 Mechanisms of regulation of phospholipase D1 by protein kinase Calpha.
12417014 2002 Protein kinase C alpha (PKC alpha): regulation and biological function.
12412804 2002 Role of protein kinase C alpha in primary human osteoblast proliferation.
12399526 Exogenous protein kinases A and C, but not endogenous prostasome-associated protein kinase, phosphorylate semenogelins I and II from human semen.
12391145 2002 Sphingosine kinase mediates vascular endothelial growth factor-induced activation of ras and mitogen-activated protein kinases.
12372816 2002 Opposing effects of PKCalpha and PKCepsilon on basolateral membrane dynamics in intestinal epithelia.
12372800 2002 Protein kinase Calpha participates in activation of store-operated Ca2+ channels in human glomerular mesangial cells.
12359212 2002 M6a acts as a nerve growth factor-gated Ca(2+) channel in neuronal differentiation.
12351631 2002 Protein kinase A negatively modulates the nuclear accumulation of NF-ATc1 by priming for subsequent phosphorylation by glycogen synthase kinase-3.
12351446 2002 Alpha-tocopherol decreases superoxide anion release in human monocytes under hyperglycemic conditions via inhibition of protein kinase C-alpha.
12269829 2002 Modulation of the human protein kinase C alpha gene promoter by activator protein-2.
12175859 Phosphorylation of the recombinant rho1 GABA receptor.
12173071 2002 Effects of the putatively oncogenic protein kinase Calpha D294G mutation on enzymatic activity and cell growth and its occurrence in human thyroid neoplasias.
12162751 2002 Characterization of PDK2 activity against protein kinase B gamma.
12149272 2002 Regulation of lipoprotein lipase by protein kinase C alpha in 3T3-F442A adipocytes.
12147342 2002 Sequence determinants on the NR2A and NR2B subunits of NMDA receptor responsible for specificity of phosphorylation by CaMKII.
12138200 2002 Site-directed perturbation of protein kinase C- integrin interaction blocks carcinoma cell chemotaxis.
12138090 2002 QM, a putative tumor suppressor, regulates proto-oncogene c-yes.
12135703 2002 Binding of elements of protein kinase C-alpha regulatory domain to lamin B1.
12134071 2002 PC phosphorylation increases the ability of AFAP-110 to cross-link actin filaments.
12112001 2002 Molecular characterization of protein kinase C-alpha binding to lamin A.
12097375 2002 Regulation of retinoid X receptor responsive element-dependent transcription in T lymphocytes by Ser/Thr phosphatases: functional divergence of protein kinase C (PKC)theta; and PKC alpha in mediating calcineurin-induced transactivation.
12093536 2002 The use of fluorescent phorbol esters in studies of protein kinase C-membrane interactions.
12080070 2002 The turn motif is a phosphorylation switch that regulates the binding of Hsp70 to protein kinase C.
12077120 2002 Interaction of 14-3-3 protein with regulator of G protein signaling 7 is dynamically regulated by tumor necrosis factor-alpha.
12064599 2001 Protein kinase Calpha mediates the effect of antiarrhythmic peptide on gap junction conductance.
12058067 2002 Extracellular signal-regulated kinase phosphorylates tumor necrosis factor alpha-converting enzyme at threonine 735: a potential role in regulated shedding.
12056906 2002 Phosphorylation of p47phox sites by PKC alpha, beta II, delta, and zeta: effect on binding to p22phox and on NADPH oxidase activation.
12054501 2002 Human serum and glucocorticoid-inducible kinase-like kinase (SGKL) phosphorylates glycogen syntheses kinase 3 beta (GSK-3beta) at serine-9 through direct interaction.
12052829 2002 Serine/threonine phosphorylation of ShcA. Regulation of protein-tyrosine phosphatase-pest binding and involvement in insulin signaling.
12034821 2002 Human OGG1 undergoes serine phosphorylation and associates with the nuclear matrix and mitotic chromatin in vivo.
12000751 2002 Regulation of retinoic acid receptor alpha by protein kinase C in B16 mouse melanoma cells.
11950841 2002 Selective association of protein kinase C with 14-3-3 zeta in neuronally differentiated PC12 Cells. Stimulatory and inhibitory effect of 14-3-3 zeta in vivo.
11937501 2002 Selectivity and promiscuity of the first and second PDZ domains of PSD-95 and synapse-associated protein 102.
11930178 2002 Nanomolar amyloid beta protein activates a specific PKC isoform mediating phosphorylation of MARCKS in Neuro2A cells.
11919157 2002 HIV-1 Tat protein induces interleukin-10 in human peripheral blood monocytes: involvement of protein kinase C-betaII and -delta.
11916978 2002 Protein kinase C (PKC) delta regulates PKCalpha activity in a Syndecan-4-dependent manner.
11910029 2002 Mass spectrometric analysis of the kinetics of in vivo rhodopsin phosphorylation.
11909826 2002 Inhibition of protein kinase Calpha prevents endothelial cell migration and vascular tube formation in vitro and myocardial neovascularization in vivo.
11904166 2002 The interaction of the bisphosphorylated N-terminal arm of cardiac troponin I-A 31P-NMR study.
11901153 2002 Protein kinase C-beta II Is an apoptotic lamin kinase in polyomavirus-transformed, etoposide-treated pyF111 rat fibroblasts.
11895774 2002 Adducin in platelets: activation-induced phosphorylation by PKC and proteolysis by calpain.
11895474 2002 Phosphorylation and reorganization of vimentin by p21-activated kinase (PAK).
11884598 2002 Convergence of multiple signaling cascades at glycogen synthase kinase 3: Edg receptor-mediated phosphorylation and inactivation by lysophosphatidic acid through a protein kinase C-dependent intracellular pathway.
11864971 2002 Calcium-dependent involucrin expression is inversely regulated by protein kinase C (PKC)alpha and PKCdelta.
11836255 2002 Molecular mechanism of the induction of metalloproteinases 1 and 3 in human fibroblasts by basic calcium phosphate crystals. Role of calcium-dependent protein kinase C alpha.
11833470 2001 [HIV-1 Tat protein induces IL-10 production by human monocytes: implications of the PKC and calcium pathway].
11805101 2002 Regulation of protein kinase C in Escherichia coli K1 invasion of human brain microvascular endothelial cells.
11788586 2002 Interaction of Bruton's tyrosine kinase and protein kinase Ctheta in platelets. Cross-talk between tyrosine and serine/threonine kinases.
11781100 2002 The Protein-tyrosine-phosphatase SHP2 is phosphorylated on serine residues 576 and 591 by protein kinase C isoforms alpha, beta 1, beta 2, and eta.
11749387 2001 Glycogen synthase kinase-3: properties, functions, and regulation.
11744641 2002 HSP27 modulates agonist-induced association of translocated RhoA and PKC-alpha in muscle cells of the colon.
11741957 2002 A lipid-regulated docking site on vinculin for protein kinase C.
11740573 2001 Isoforms of protein kinase C and their distribution in human adrenal cortex and tumors.
11700305 2002 Phosphorylation of the cytoplasmic domain of the integrin CD18 chain by protein kinase C isoforms in leukocytes.
11588141 2001 Mechanisms and physiological significance of the cholinergic control of pancreatic beta-cell function.
11557526 2001 Association of protein kinase A with AKAP150 facilitates pepsinogen secretion from gastric chief cells.
11517287 2001 Expression and function of the HSD-3.8 gene encoding a testis-specific protein.
11502742 2001 Protein kinase C regulates the phosphorylation and cellular localization of occludin.
11498053 2001 Multiple phosphorylation of rhodopsin and the in vivo chemistry underlying rod photoreceptor dark adaptation.
11466413 2001 PICK1 targets activated protein kinase Calpha to AMPA receptor clusters in spines of hippocampal neurons and reduces surface levels of the AMPA-type glutamate receptor subunit 2.
11438671 2001 Mitotic phosphorylation prevents the binding of HMGN proteins to chromatin.
11399752 2001 Sequential activation of protein kinase C (PKC)-alpha and PKC-epsilon contributes to sustained Raf/ERK1/2 activation in endothelial cells under mechanical strain.
11397799 2001 Histamine-induced vasoconstriction involves phosphorylation of a specific inhibitor protein for myosin phosphatase by protein kinase C alpha and delta isoforms.
11387207 2001 Ezrin is a downstream effector of trafficking PKC-integrin complexes involved in the control of cell motility.
11343707 2001 Phosphorylation of murine homeodomain protein Dlx3 by protein kinase C.
11342557 2001 HSP22, a new member of the small heat shock protein superfamily, interacts with mimic of phosphorylated HSP27 ((3D)HSP27).
11325968 2001 Transmembrane-4 superfamily proteins associate with activated protein kinase C (PKC) and link PKC to specific beta(1) integrins.
11325528 2001 Regulation of the ErbB3 binding protein Ebp1 by protein kinase C.
11316952 Intracellular distribution of gravin, a PKA and PKC binding protein, in vascular endothelial cells.
11306676 2001 Evidence for direct protein kinase-C mediated modulation of N-methyl-D-aspartate receptor current.
11298324 2001 Interaction of CD163 with the regulatory subunit of casein kinase II (CKII) and dependence of CD163 signaling on CKII and protein kinase C.
11284700 2001 Interaction of protein kinase C isozymes with Rho GTPases.
11278470 2001 Protein kinase C alpha -mediated negative feedback regulation is responsible for the termination of insulin-like growth factor I-induced activation of nuclear phospholipase C beta1 in Swiss 3T3 cells.
11278415 2001 Activation of annexin 7 by protein kinase C in vitro and in vivo.
11273731 2001 Protein kinase C-alpha and -epsilon modulate connexin-43 phosphorylation in human heart.
11248124 2001 Competitive regulation of CaT-like-mediated Ca2+ entry by protein kinase C and calmodulin.
11246878 2001 Cellular mechanism of nutritionally induced insulin resistance in Psammomys obesus: overexpression of protein kinase Cepsilon in skeletal muscle precedes the onset of hyperinsulinemia and hyperglycemia.
11238007 2001 IL-1beta enhances beta2-adrenergic receptor expression in human airway epithelial cells by activating PKC.
11237868 2001 Mitogen-stimulated TIS21 protein interacts with a protein-kinase-Calpha-binding protein rPICK1.
11154208 2001 HIV-1 Tat promotes monocyte chemoattractant protein-1 secretion followed by transmigration of monocytes.
11145703 2001 Protein kinase C zeta phosphorylates a subset of selective sites of the NADPH oxidase component p47phox and participates in formyl peptide-mediated neutrophil respiratory burst.
11123317 2001 Role of two conserved cytoplasmic threonine residues (T410 and T412) in CD5 signaling.
11121119 2001 Additional PKA phosphorylation sites in human cardiac troponin I.
11104776 2001 Protein kinase C activation modulates alpha-calmodulin kinase II binding to NR2A subunit of N-methyl-D-aspartate receptor complex.
11085981 2001 Heterologous activation of protein kinase C stimulates phosphorylation of delta-opioid receptor at serine 344, resulting in beta-arrestin- and clathrin-mediated receptor internalization.
11063746 2001 Protein kinase C phosphorylates RGS2 and modulates its capacity for negative regulation of Galpha 11 signaling.
11044099 2000 Tat protein of human immunodeficiency virus type 1 induces interleukin-10 in human peripheral blood monocytes: implication of protein kinase C-dependent pathway.
11042191 2001 Phosphorylation of GRK2 by protein kinase C abolishes its inhibition by calmodulin.
11042115 2000 Insulin-induced phospholipase D1 and phospholipase D2 activity in human embryonic kidney-293 cells mediated by the phospholipase C gamma and protein kinase C alpha signalling cascade.
11035810 2000 Phosphorylation and inactivation of glycogen synthase kinase 3 by protein kinase A.
11024037 2001 Regulation of Cbl molecular interactions by the co-receptor molecule CD43 in human T cells.
11007883 2000 Phosphorylation of the AMPA receptor subunit GluR2 differentially regulates its interaction with PDZ domain-containing proteins.
10993892 2000 Erk1/2-dependent phosphorylation of Galpha-interacting protein stimulates its GTPase accelerating activity and autophagy in human colon cancer cells.
10970850 2000 Ezrin function is required for ROCK-mediated fibroblast transformation by the Net and Dbl oncogenes.
10934041 2000 Activation of protein kinase Calpha inhibits growth of pancreatic cancer cells via p21(cip)-mediated G(1) arrest.
10912793 2000 Activation of mitogen-activated protein kinases is required for alpha1-adrenergic agonist-induced cell scattering in transfected HepG2 cells.
10874031 2000 Inhibition of neuronal nitric-oxide synthase by calcium/ calmodulin-dependent protein kinase IIalpha through Ser847 phosphorylation in NG108-15 neuronal cells.
10871288 2000 Phosphorylation of connexin43 on serine368 by protein kinase C regulates gap junctional communication.
10861222 2000 Expression, purification and characterization of recombinant human choline acetyltransferase: phosphorylation of the enzyme regulates catalytic activity.
10858434 2000 Dynamic interaction of human vasopressin/oxytocin receptor subtypes with G protein-coupled receptor kinases and protein kinase C after agonist stimulation.
10856305 2000 Protein kinase C phosphorylation of syntaxin 4 in thrombin-activated human platelets.
10848585 2000 Involvement of p21(Waf1/Cip1) in protein kinase C alpha-induced cell cycle progression.
10843712 2000 Release of calcium from inositol 1,4,5-trisphosphate receptor-regulated stores by HIV-1 Tat regulates TNF-alpha production in human macrophages.
10831594 2000 Protein kinase C [micro] is regulated by the multifunctional chaperon protein p32.
10825394 2000 Bryostatin 1 induces prolonged activation of extracellular regulated protein kinases in and apoptosis of LNCaP human prostate cancer cells overexpressing protein kinase calpha.
10823959 2000 Opposing effects of protein kinase C and protein kinase A on metabotropic glutamate receptor signaling: selective desensitization of the inositol trisphosphate/Ca2+ pathway by phosphorylation of the receptor-G protein-coupling domain.
10816571 2000 Interaction between endothelial differentiation-related factor-1 and calmodulin in vitro and in vivo.
10806197 2000 Phosphorylation of human glutamine:fructose-6-phosphate amidotransferase by cAMP-dependent protein kinase at serine 205 blocks the enzyme activity.
10779366 2000 Regulation of recombinant gamma-aminobutyric acid (GABA)(A) and GABA(C) receptors by protein kinase C.
10770950 2000 Regulation of phospholipid scramblase activity during apoptosis and cell activation by protein kinase Cdelta.
10766777 2000 Phosphorylation of dynamin I on Ser-795 by protein kinase C blocks its association with phospholipids.
10760275 2000 Membrane-associated GAIP is a phosphoprotein and can be phosphorylated by clathrin-coated vesicles.
10739259 2000 Phosphorylation and subcellular redistribution of high mobility group proteins 14 and 17, analyzed by mass spectrometry.
10667577 2000 Protein phosphorylation is a regulatory mechanism for O6-alkylguanine-DNA alkyltransferase in human brain tumor cells.
10628374 Interaction between protein kinase C and actin in megakaryocyte polyploidization.
10617144 2000 Phosphorylation of HMG-I by protein kinase C attenuates its binding affinity to the promoter regions of protein kinase C gamma and neurogranin/RC3 genes.
10531036 1999 Regulation of ARNO nucleotide exchange by a PH domain electrostatic switch.
10501226 1999 Phosphorylation of serine-880 in GluR2 by protein kinase C prevents its C terminus from binding with glutamate receptor-interacting protein.
10477766 1999 Protein kinase C-dependent mobilization of the alpha6beta4 integrin from hemidesmosomes and its association with actin-rich cell protrusions drive the chemotactic migration of carcinoma cells.
10441128 1999 Phosphorylation and activation of phospholipase D1 by protein kinase C in vivo: determination of multiple phosphorylation sites.
10433554 1999 14-3-3Gamma interacts with and is phosphorylated by multiple protein kinase C isoforms in PDGF-stimulated human vascular smooth muscle cells.
10400690 1999 Regulation of neuronal nitric-oxide synthase by calmodulin kinases.
10366608 1999 Characterization of phosphorylation sites on the glutamate receptor 4 subunit of the AMPA receptors.
10339425 1999 Rapamycin-sensitive phosphorylation of PKC on a carboxy-terminal site by an atypical PKC complex.
10212259 1999 Ca2+/calmodulin-dependent protein kinase II regulates Tiam1 by reversible protein phosphorylation.
10194441 1999 Human platelets contain SNARE proteins and a Sec1p homologue that interacts with syntaxin 4 and is phosphorylated after thrombin activation: implications for platelet secretion.
9935181 1999 Effect of serum starvation on expression and phosphorylation of PKC-alpha and p53 in V79 cells: implications for cell death.
9927633 1999 Induction of p53-dependent, insulin-like growth factor-binding protein-3-mediated apoptosis in glioblastoma multiforme cells by a protein kinase Calpha antisense oligonucleotide.
9873035 1999 Interleukin-1-induced nuclear factor-kappaB-IkappaBalpha autoregulatory feedback loop in hepatocytes. A role for protein kinase calpha in post-transcriptional regulation of ikappabalpha resynthesis.
9853757 1998 Functional interaction between InsP3 receptors and store-operated Htrp3 channels.
9839716 1998 Consensus phosphorylation sites of human GABA(c)/GABArho receptors are not critical for inhibition by protein kinase C activation.
9837921 1998 Telomerase is controlled by protein kinase Calpha in human breast cancer cells.
9830023 1998 Protein kinase C-alpha modulates lipopolysaccharide-induced functions in a murine macrophage cell line.
9814702 1998 Protein kinase C as a molecular machine for decoding calcium and diacylglycerol signals.
9738012 1998 A functional role for mitochondrial protein kinase Calpha in Bcl2 phosphorylation and suppression of apoptosis.
9722557 1998 Phosphorylation of the prostacyclin receptor during homologous desensitization. A critical role for protein kinase c.
9721757 1998 Endothelin induces a calcium-dependent phosphorylation of PEA-15 in intact astrocytes: identification of Ser104 and Ser116 phosphorylated, respectively, by protein kinase C and calcium/calmodulin kinase II in vitro.
9716136 1998 Protein kinase C regulates the nuclear localization of diacylglycerol kinase-zeta.
9694886 1998 Protein kinase C phosphorylation of threonine at position 888 in Ca2+o-sensing receptor (CaR) inhibits coupling to Ca2+ store release.
9677319 1998 Effects of phosphorylation on function of the Rad GTPase.
9671211 1998 Human immunodeficiency virus Tat protein induces interleukin 6 mRNA expression in human brain endothelial cells via protein kinase C- and cAMP-dependent protein kinase pathways.
9647734 1998 Kell and Kx, two disulfide-linked proteins of the human erythrocyte membrane are phosphorylated in vivo.
9624226 1998 Growth and metabolism of fetal and maternal muscles of adolescent sheep on adequate or high feed intake: possible role of protein kinase C-alpha in fetal muscle growth.
9571186 1998 Regulation of the p53 protein by protein kinase C alpha and protein kinase C zeta.
9566962 1998 Targeting of protein kinase Calpha to caveolae.
9556568 1998 Regulation of syndecan-4 phosphorylation in vivo.
9506976 1998 A role for receptor kinases in the regulation of class II G protein-coupled receptors. Phosphorylation and desensitization of the secretin receptor.
9468546 Protein kinase C-alpha: a novel target for the therapy of androgen-independent prostate cancer? (Review-hypothesis).
9446795 1998 Extracellular HIV-1 Tat protein induces a rapid and selective activation of protein kinase C (PKC)-alpha, and -epsilon and -zeta isoforms in PC12 cells.
9405395 1997 Specific interaction of the PDZ domain protein PICK1 with the COOH terminus of protein kinase C-alpha.
9389649 1997 Mediation of NGF signaling by post-translational inhibition of HES-1, a basic helix-loop-helix repressor of neuronal differentiation.
9374536 1997 Expression, purification, and regulation of two isoforms of the inositol 1,4,5-trisphosphate 3-kinase.
9353340 1997 Characterization of the phosphorylation sites involved in G protein-coupled receptor kinase- and protein kinase C-mediated desensitization of the alpha1B-adrenergic receptor.
9346285 1997 The ordered phosphorylation of cardiac troponin I by the cAMP-dependent protein kinase--structural consequences and functional implications.
9341215 1997 Site-specific phosphorylation of the human immunodeficiency virus type-1 Rev protein accelerates formation of an efficient RNA-binding conformation.
9341188 1997 The prooncoprotein EWS binds calmodulin and is phosphorylated by protein kinase C through an IQ domain.
9244383 1997 Serine phosphorylation of syndecan-2 proteoglycan cytoplasmic domain.
9242710 1997 Phosphorylation and calmodulin binding of the metabotropic glutamate receptor subtype 5 (mGluR5) are antagonistic in vitro.
9155020 1997 D-myo-inositol 1,4,5-trisphosphate 3-kinase A is activated by receptor activation through a calcium:calmodulin-dependent protein kinase II phosphorylation mechanism.
9151826 1997 The Nef protein of human immunodeficiency virus type 1 enhances serine phosphorylation of the viral matrix.
9109675 1997 Phosphorylation of Alzheimer beta-amyloid precursor-like proteins.
9099669 1997 Identification of protein kinase C phosphorylation sites on bovine rhodopsin.
9099667 1997 Phosphorylation of glial fibrillary acidic protein at the same sites by cleavage furrow kinase and Rho-associated kinase.
9072970 1997 Nuclear export of NF-ATc enhanced by glycogen synthase kinase-3.
9030777 1997 Phosphorylation of vitronectin on Ser362 by protein kinase C attenuates its cleavage by plasmin.
9030586 1997 Protein kinase A (PKA)- and protein kinase C-phosphorylated glia maturation factor promotes the catalytic activity of PKA.
9016777 1997 QM is a novel zinc-binding transcription regulatory protein: its binding to c-Jun is regulated by zinc ions and phosphorylation by protein kinase C.
8940188 1996 Identification of a phosphorylation site for calcium/calmodulindependent protein kinase II in the NR2B subunit of the N-methyl-D-aspartate receptor.
8940095 1996 Protein-protein interaction of zinc finger LIM domains with protein kinase C.
8914829 1996 In vitro phosphorylation of human immunodeficiency virus type 1 Tat protein by protein kinase C: evidence for the phosphorylation of amino acid residue serine-46.
8856079 1996 Replacement of Ser657 of protein kinase C-alpha by alanine leads to premature down regulation after phorbol-ester-induced translocation to the membrane.
8848293 1995 Antibody specific for phosphorylated AMPA-type glutamate receptors at GluR2 Ser-696.
8798526 1996 Phosphorylation specificities of protein kinase C isozymes for bovine cardiac troponin I and troponin T and sites within these proteins and regulation of myofilament properties.
8663994 1996 Characterization of multiple phosphorylation sites on the AMPA receptor GluR1 subunit.
8663267 1996 Phosphorylation of purified bovine bone sialoprotein and osteopontin by protein kinases.
8662663 1996 Phosphorylation of eIF-4E on serine 209 by protein kinase C is inhibited by the translational repressors, 4E-binding proteins.
8647866 1996 Protein kinase C phosphorylates G12 alpha and inhibits its interaction with G beta gamma.
8631738 1996 Phosphorylation of Munc-18/n-Sec1/rbSec1 by protein kinase C: its implication in regulating the interaction of Munc-18/n-Sec1/rbSec1 with syntaxin.
8627654 1996 Extracellular human immunodeficiency virus type 1 Tat protein is associated with an increase in both NF-kappa B binding and protein kinase C activity in primary human astrocytes.
8617805 1996 Structural and enzymatic aspects of rhodopsin phosphorylation.
8557118 1996 PRK1 phosphorylates MARCKS at the PKC sites: serine 152, serine 156 and serine 163.
8530412 1995 Phosphorylation of the cytosolic domain of peptidylglycine alpha-amidating monooxygenase.
8506364 1993 Phosphorylation of Ser-42 and Ser-59 in the N-terminal region of the tyrosine kinase p56lck.
8477740 1993 Identification of novel phosphorylation sites in murine A-type lamins.
8473314 1993 Phosphorylation of HIV-1 gag proteins by protein kinase C.
8463287 1993 Interaction of the human insulin receptor tyrosine kinase from the baculovirus expression system with protein kinase C in a cell-free system.
8404858 1993 Multiple and cooperative phosphorylation events regulate the CREM activator function.
8390988 1993 Phosphorylation of connexin-32 by protein kinase C prevents its proteolysis by mu-calpain and m-calpain.
8321321 1993 Protein kinase C alpha activates RAF-1 by direct phosphorylation.
8206971 1994 Differential activation of adenylyl cyclase by protein kinase C isoenzymes.
8089108 1994 The phosphorylation of the respiratory burst oxidase component p47phox during neutrophil activation. Phosphorylation of sites recognized by protein kinase C and by proline-directed kinases.
8080473 1993 Characterization of a 7.5-kDa protein kinase C substrate (RC3 protein, neurogranin) from rat brain.
8077302 1993 Invasive human pituitary tumors express a point-mutated alpha-protein kinase-C.
8034575 1994 Myristoylated alanine-rich C kinase substrate (MARCKS), a major protein kinase C substrate, is an in vivo substrate of proline-directed protein kinase(s). A mass spectroscopic analysis of the post-translational modifications.
7935319 1994 Rapid heterologous desensitization of muscarinic and thrombin receptor-mediated phospholipase D activation.
7926007 1994 Identification of serines-1035/1037 in the kinase domain of the insulin receptor as protein kinase C alpha mediated phosphorylation sites.
7925482 1993 Functional analysis of phosphorylation sites in human lamin A controlling lamin disassembly, nuclear transport and assembly.
7876254 1995 Characterization of Rad, a new member of Ras/GTPase superfamily, and its regulation by a unique GTPase-activating protein (GAP)-like activity.
7876252 1995 Regulation of HIV-1 gag protein subcellular targeting by protein kinase C.
7822264 1994 Identification of phosphorylation sites on glial fibrillary acidic protein for cdc2 kinase and Ca(2+)-calmodulin-dependent protein kinase II.
7759492 1995 Regulation of adenylyl cyclase by protein kinase A.
7646439 1995 Mechanisms of platelet activation by a stimulatory antibody: cross-linking of a novel platelet receptor for monoclonal antibody F11 with the Fc gamma RII receptor.
7644499 1995 The product of the ataxia-telangiectasia group D complementing gene, ATDC, interacts with a protein kinase C substrate and inhibitor.
7595479 1995 Modulation of a recombinant glycine transporter (GLYT1b) by activation of protein kinase C.
7539802 1995 Identification of the major phosphorylation sites for protein kinase C in kit/stem cell factor receptor in vitro and in intact cells.
7525583 1994 Regulation of p68 RNA helicase by calmodulin and protein kinase C.
7523419 1994 Identification of the major physiologic phosphorylation site of human keratin 18: potential kinases and a role in filament reorganization.
7522330 1994 The pleckstrin homology domain of Bruton tyrosine kinase interacts with protein kinase C.
7520867 1994 PTP-PEST: a protein tyrosine phosphatase regulated by serine phosphorylation.
7520444 1994 Modulation of Kit/stem cell factor receptor-induced signaling by protein kinase C.
7499337 1995 Cell cycle phase-specific phosphorylation of human topoisomerase II alpha. Evidence of a role for protein kinase C.
3755548 1986 Multiple, distinct forms of bovine and human protein kinase C suggest diversity in cellular signaling pathways.
3472757 1986 Protein kinases in cellular signal transduction: tyrosine kinase growth factor receptors and protein kinase C.
3160694 1985 Phosphorylation of smooth muscle myosin light chain kinase by protein kinase C. Comparative study of the phosphorylated sites.
2996780 1985 Protein kinase C phosphorylates pp60src at a novel site.
2946940 1986 The protein-tyrosine kinase substrate p36 is also a substrate for protein kinase C in vitro and in vivo.
2941417 1986 Identification of lymphocyte integral membrane proteins as substrates for protein kinase C. Phosphorylation of the interleukin-2 receptor, class I HLA antigens, and T200 glycoprotein.
2584239 1989 Identification of sites phosphorylated in bovine cardiac troponin I and troponin T by protein kinase C and comparative substrate activity of synthetic peptides containing the phosphorylation sites.
2500966 1989 Domain- and sequence-specific phosphorylation of vimentin induces disassembly of the filament structure.
2473066 1989 Characterization of the phosphorylation sites in the chicken and bovine myristoylated alanine-rich C kinase substrate protein, a prominent cellular substrate for protein kinase C.
2413024 1985 Studies on the phosphorylation of myelin basic protein by protein kinase C and adenosine 3':5'-monophosphate-dependent protein kinase.
2336401 1990 Sequence of human protein kinase C alpha.
2182321 1990 Trans-activation of HIV-1 LTR-directed gene expression by tat requires protein kinase C.
2155236 1990 Phosphorylation sites linked to glial filament disassembly in vitro locate in a non-alpha-helical head domain.
2114109 1990 Ca2(+)-calmodulin-dependent protein kinase II phosphorylates various types of non-epithelial intermediate filament proteins.
2061327 1991 Phosphorylation of elongation factor 1 (EF-1) and valyl-tRNA synthetase by protein kinase C and stimulation of EF-1 activity.
2040602 1991 Inactivation of DNA polymerase beta by in vitro phosphorylation with protein kinase C.
1827443 1991 Protein kinase C phosphorylates the carboxyl terminus of the plasma membrane Ca(2+)-ATPase from human erythrocytes.
1714454 1991 Phorbol diester-induced alterations in the expression of protein kinase C isozymes and their mRNAs. Analysis in wild-type and phorbol diester-resistant HL-60 cell clones.
1663499 1991 Refinement of localization of the human genes for myeloperoxidase (MPO), protein kinase C, alpha polypeptide, PRKCA, and the DNA fragment D17S21 on chromosome 17q.
1553557 1992 An amino acid mutation in a potassium channel that prevents inhibition by protein kinase C.
1454855 1992 Characterization of the tumor suppressor protein p53 as a protein kinase C substrate and a S100b-binding protein.
1377674 1992 Phosphorylation of the cystic fibrosis transmembrane conductance regulator.
1375933 1992 Nitric oxide synthase regulatory sites. Phosphorylation by cyclic AMP-dependent protein kinase, protein kinase C, and calcium/calmodulin protein kinase; identification of flavin and calmodulin binding sites.
1374067 1992 PKC epsilon-related kinase associates with and phosphorylates cytokeratin 8 and 18.
1335366 1992 FGF inactivates myogenic helix-loop-helix proteins through phosphorylation of a conserved protein kinase C site in their DNA-binding domains.
1322130 1992 The two forms of bovine heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase result from alternative splicing.
1321150 1992 Identification of the cAMP-dependent protein kinase and protein kinase C phosphorylation sites within the major intracellular domains of the beta 1, gamma 2S, and gamma 2L subunits of the gamma-aminobutyric acid type A receptor.