Property Summary

NCBI Gene PubMed Count 70
PubMed Score 179.89
PubTator Score 67.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (33)

Disease log2 FC p
gastric cancer 1.200 8.3e-03
pancreatic cancer 1.700 1.5e-03
malignant mesothelioma 1.500 2.2e-04
astrocytic glioma -2.300 4.3e-03
ependymoma -2.700 3.6e-03
oligodendroglioma -1.500 2.3e-02
psoriasis -1.300 1.1e-04
glioblastoma -2.200 4.8e-05
cystic fibrosis 1.825 2.5e-06
atypical teratoid / rhabdoid tumor -2.100 4.8e-04
medulloblastoma, large-cell -2.800 1.6e-03
Duchenne muscular dystrophy 1.073 4.0e-03
autosomal dominant Emery-Dreifuss muscul... 2.170 3.3e-03
acute quadriplegic myopathy 1.110 9.9e-06
tuberculosis 1.100 1.2e-02
non-small cell lung cancer -1.107 3.1e-09
intraductal papillary-mucinous adenoma (... -3.600 2.9e-05
intraductal papillary-mucinous carcinoma... -3.800 2.5e-05
intraductal papillary-mucinous neoplasm ... -2.800 1.2e-02
colon cancer -1.800 5.0e-07
lung cancer -1.800 1.3e-04
active Crohn's disease 1.671 1.8e-02
sarcoidosis 1.500 4.6e-03
pediatric high grade glioma -1.500 3.6e-03
pilocytic astrocytoma -1.600 6.8e-04
non primary Sjogren syndrome sicca 1.300 1.6e-02
pancreatic carcinoma 1.700 1.5e-03
invasive ductal carcinoma -3.000 5.7e-03
nasopharyngeal carcinoma 1.200 3.1e-02
severe Alzheimer's disease -1.345 3.4e-02
ductal carcinoma in situ -2.700 5.4e-04
ulcerative colitis 1.600 6.5e-07
ovarian cancer -3.700 4.4e-09

Gene RIF (30)

PMID Text
26158466 Release of pRIIbeta in the presence of cAMP is reduced by calcium, whereas autophosphorylation at the phosphorylation site inhibits holoenzyme reassociation with the catalytic subunit.
25477193 Leu206Arg and Leu199_Cys200insTrp mutations in PRKACA impair its association with PRKAR2B and PRKAR1A.
25268545 Although the depletion of PRKAR1A and PRKAR2B in adrenocortical cells has similar effects on cell proliferation and apoptosis; loss of these PKA subunits differentially affects cyclin expression.
24737441 Because of limited power, PRKAR2B's role in antipsychotic-induced weight gain is unclear, but biological evidence suggests that PRKAR2B may be involved
24189052 Protein kinase A (PKA) binds and phosphorylates A3G at Thr32 in vitro and in vivo. This phosphorylation event reduces the binding of A3G to Vif and its subsequent ubiquitination and degradation
21651489 Protein kinase A (PKA) binds and phosphorylates A3G at Thr32 in vitro and in vivo. This phosphorylation event reduces the binding of A3G to Vif and its subsequent ubiquitination and degradation
21068099 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20402410 Protein kinase A (PKA) binds and phosphorylates A3G at Thr32 in vitro and in vivo. This phosphorylation event reduces the binding of A3G to Vif and its subsequent ubiquitination and degradation
20392842 Protein kinase A (PKA) binds and phosphorylates A3G at Thr32 in vitro and in vivo. This phosphorylation event reduces the binding of A3G to Vif and its subsequent ubiquitination and degradation
20379146 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20195266 Clinical trial and genome-wide association study of gene-disease association. (HuGE Navigator)
19895210 Protein kinase A (PKA) binds and phosphorylates A3G at Thr32 in vitro and in vivo. This phosphorylation event reduces the binding of A3G to Vif and its subsequent ubiquitination and degradation
18836454 Protein kinase A (PKA) binds and phosphorylates A3G at Thr32 in vitro and in vivo. This phosphorylation event reduces the binding of A3G to Vif and its subsequent ubiquitination and degradation
18625701 both the constitutive and cAMP-induced release of TNFR1 exosome-like vesicles occur via PKA-dependent pathways that are regulated by the anchoring of RIIbeta to BIG2 via AKAP domains B and C
18544528 PKA RII(beta) is responsible for increased glucocorticoid sensitivity, critical for cAMP-mediated synergistic cell killing in CEM cells
18505904 Loss of PRKAR2B protein due to a post-transcriptional mechanism in ACA-S is a new mechanism of cAMP pathway dysregulation in adrenocortical tumorigenesis.
17904549 A high R1/R2 ratio favors the proliferation of well differentiated and hormone producing adrenocortical cells, while unbalanced expression of these subunits is not required for malignant transformation.
17168834 Protein kinase A (PKA) binds and phosphorylates A3G at Thr32 in vitro and in vivo. This phosphorylation event reduces the binding of A3G to Vif and its subsequent ubiquitination and degradation
15629779 Protein kinase A (PKA) binds and phosphorylates A3G at Thr32 in vitro and in vivo. This phosphorylation event reduces the binding of A3G to Vif and its subsequent ubiquitination and degradation
15187164 serine 114 phosphorylation and nuclear localization of RIIbeta controls the regulation of IL-2 gene expression in T cells.
14744463 there are abnormalities in [3H]cAMP binding and catalytic activity kinase A in brain of depressed suicide victims, which could be due to reduced expression of RIIbeta and Cbeta
14500661 Nuclear RII beta can act as a repressor of CREB transcriptional activity in T cells, providing a potential functional significance for aberrant levels of nuclear RII beta in systemic lupus erythematosus T cells.
12727985 lipolytic catecholamine resistance of sc adipocytes in polycystic ovary syndrome is probably due to a combination of decreased amounts of beta(2)-adrenergic receptors, the regulatory II beta-component of protein kinase A, and hormone-sensitive lipase
9730685 Protein kinase A (PKA) binds and phosphorylates A3G at Thr32 in vitro and in vivo. This phosphorylation event reduces the binding of A3G to Vif and its subsequent ubiquitination and degradation
9671211 Protein kinase A (PKA) binds and phosphorylates A3G at Thr32 in vitro and in vivo. This phosphorylation event reduces the binding of A3G to Vif and its subsequent ubiquitination and degradation
9278385 Protein kinase A (PKA) binds and phosphorylates A3G at Thr32 in vitro and in vivo. This phosphorylation event reduces the binding of A3G to Vif and its subsequent ubiquitination and degradation
9151826 Protein kinase A (PKA) binds and phosphorylates A3G at Thr32 in vitro and in vivo. This phosphorylation event reduces the binding of A3G to Vif and its subsequent ubiquitination and degradation
7946090 Protein kinase A (PKA) binds and phosphorylates A3G at Thr32 in vitro and in vivo. This phosphorylation event reduces the binding of A3G to Vif and its subsequent ubiquitination and degradation
7688126 Protein kinase A (PKA) binds and phosphorylates A3G at Thr32 in vitro and in vivo. This phosphorylation event reduces the binding of A3G to Vif and its subsequent ubiquitination and degradation
1978848 Protein kinase A (PKA) binds and phosphorylates A3G at Thr32 in vitro and in vivo. This phosphorylation event reduces the binding of A3G to Vif and its subsequent ubiquitination and degradation

AA Sequence

MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGDLGAAAGGGTP      1 - 70
SKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAYNPDEEEDDAESRIIHPKTDD     71 - 140
QRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGR    141 - 210
CVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSL    211 - 280
EFSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYF    281 - 350
GELALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA      351 - 418
//

Text Mined References (77)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26158466 2015 Single Turnover Autophosphorylation Cycle of the PKA RII? Holoenzyme.
25477193 2014 PKA catalytic subunit mutations in adrenocortical Cushing's adenoma impair association with the regulatory subunit.
25268545 2014 Comparison of the effects of PRKAR1A and PRKAR2B depletion on signaling pathways, cell growth, and cell cycle control of adrenocortical cells.
24737441 2014 Protein kinase cAMP-dependent regulatory type II beta (PRKAR2B) gene variants in antipsychotic-induced weight gain.
24662972 2014 Genome-wide interaction study of smoking and bladder cancer risk.
24605759 2014 Cyclic nucleotide mapping of hyperpolarization-activated cyclic nucleotide-gated (HCN) channels.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22379998 2012 Genome-wide mapping for clinically relevant predictors of lamotrigine- and phenytoin-induced hypersensitivity reactions.
21812984 2011 The testis-specific C?2 subunit of PKA is kinetically indistinguishable from the common C?1 subunit of PKA.
21423175 2011 Control of PKA stability and signalling by the RING ligase praja2.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
21068099 2011 Meta-analysis of genome-wide association studies confirms a susceptibility locus for knee osteoarthritis on chromosome 7q22.
20379146 2010 Biological pathway-based genome-wide association analysis identified the vasoactive intestinal peptide (VIP) pathway important for obesity.
20195266 2011 Genomewide pharmacogenomic study of metabolic side effects to antipsychotic drugs.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18625701 2008 cAMP-dependent protein kinase A (PKA) signaling induces TNFR1 exosome-like vesicle release via anchoring of PKA regulatory subunit RIIbeta to BIG2.
18544528 2008 Protein kinase A (PKA) isoform RIIbeta mediates the synergistic killing effect of cAMP and glucocorticoid in acute lymphoblastic leukemia cells.
18505904 2008 Identification of a clinically homogenous subgroup of benign cortisol-secreting adrenocortical tumors characterized by alterations of the protein kinase A (PKA) subunits and high PKA activity.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17904549 2008 Different expression of protein kinase A (PKA) regulatory subunits in cortisol-secreting adrenocortical tumors: relationship with cell proliferation.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16407073 2006 Dynamic binding of PKA regulatory subunit RI alpha.
16381901 2006 The LIFEdb database in 2006.
15822905 Phosphoproteomic analysis of synaptosomes from human cerebral cortex.
15569306 2004 D1 dopamine receptor signaling involves caveolin-2 in HEK-293 cells.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15187164 2004 Down-regulation of IL-2 production in T lymphocytes by phosphorylated protein kinase A-RIIbeta.
14744463 2004 Protein kinase A in postmortem brain of depressed suicide victims: altered expression of specific regulatory and catalytic subunits.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14500661 2003 Protein kinase A regulatory subunit type II beta directly interacts with and suppresses CREB transcriptional activity in activated T cells.
12853948 2003 The DNA sequence of human chromosome 7.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12727985 2003 Mechanisms behind lipolytic catecholamine resistance of subcutaneous fat cells in the polycystic ovarian syndrome.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12626323 2003 Glucagon and regulation of glucose metabolism.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475942 2002 Characterization of an A-kinase anchoring protein in human ciliary axonemes.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
11799244 2002 Requirement of a macromolecular signaling complex for beta adrenergic receptor modulation of the KCNQ1-KCNE1 potassium channel.
11591815 2001 Positive regulation of cell-cell and cell-substrate adhesion by protein kinase A.
11342137 2001 Molecular basis for regulatory subunit diversity in cAMP-dependent protein kinase: crystal structure of the type II beta regulatory subunit.
11102458 2000 Neurobeachin: A protein kinase A-anchoring, beige/Chediak-higashi protein homolog implicated in neuronal membrane traffic.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10864471 2000 Localization of a novel human A-kinase-anchoring protein, hAKAP220, during spermatogenesis.
10228048 1999 Diminished levels of protein kinase A RI alpha and RI beta transcripts and proteins in systemic lupus erythematosus T lymphocytes.
9852104 1998 Identification of tethering domains for protein kinase A type Ialpha regulatory subunits on sperm fibrous sheath protein FSC1.
9730685 HIV-1 tat molecular diversity and induction of TNF-alpha: implications for HIV-induced neurological disease.
9671211 1998 Human immunodeficiency virus Tat protein induces interleukin 6 mRNA expression in human brain endothelial cells via protein kinase C- and cAMP-dependent protein kinase pathways.
9326583 1997 D-AKAP2, a novel protein kinase A anchoring protein with a putative RGS domain.
9278385 1997 The Tat protein of HIV-1 induces tumor necrosis factor-alpha production. Implications for HIV-1-associated neurological diseases.
9151826 1997 The Nef protein of human immunodeficiency virus type 1 enhances serine phosphorylation of the viral matrix.
8516283 1993 Phosphorylation of the regulatory subunit of type II beta cAMP-dependent protein kinase by cyclin B/p34cdc2 kinase impairs its binding to microtubule-associated protein 2.
8509414 1993 Characterization of distinct tethering and intracellular targeting domains in AKAP75, a protein that links cAMP-dependent protein kinase II beta to the cytoskeleton.
7946090 1994 HIV Gag p17 protein impairs proliferation of normal lymphocytes in vitro.
7829531 1995 Mutagenesis of the regulatory subunit (RII beta) of cAMP-dependent protein kinase II beta reveals hydrophobic amino acids that are essential for RII beta dimerization and/or anchoring RII beta to the cytoskeleton.
7798223 1994 1,25-dihydroxyvitamin D3 alters the effect of cAMP in thyroid cells by increasing the regulatory subunit type II beta of the cAMP-dependent protein kinase.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.
7688126 1993 Human immunodeficiency virus proteins induce the inhibitory cAMP/protein kinase A pathway in normal lymphocytes.
7479855 1995 Point mutation of the autophosphorylation site or in the nuclear location signal causes protein kinase A RII beta regulatory subunit to lose its ability to revert transformed fibroblasts.
3691190 1987 A human regulatory subunit of type II cAMP-dependent protein kinase localized by its linkage relationship to several cloned chromosome 7q markers.
3479018 1987 Exclusion of catalytic and regulatory subunits of cAMP-dependent protein kinase as candidate genes for the defect causing cystic fibrosis.
2851102 1988 Molecular cloning, complementary deoxyribonucleic acid structure and predicted full-length amino acid sequence of the hormone-inducible regulatory subunit of 3'-5'-cyclic adenosine monophosphate-dependent protein kinase from human testis.
2165385 1990 cAMP-dependent protein kinase: framework for a diverse family of regulatory enzymes.
1978848 1990 HIV inhibits the early steps of lymphocyte activation, including initiation of inositol phospholipid metabolism.
1689049 1990 An antisense oligodeoxynucleotide targeted against the type II beta regulatory subunit mRNA of protein kinase inhibits cAMP-induced differentiation in HL-60 leukemia cells without affecting phorbol ester effects.
1582408 1992 Identification of a high affinity binding protein for the regulatory subunit RII beta of cAMP-dependent protein kinase in Golgi enriched membranes of human lymphoblasts.
1358799 1992 Mapping of the regulatory subunits RI beta and RII beta of cAMP-dependent protein kinase genes on human chromosome 7.
1332964 1992 Characterization of a minimal promoter element required for transcription of the mouse type II beta regulatory subunit (RII beta) of cAMP-dependent protein kinase.