Property Summary

NCBI Gene PubMed Count 99
PubMed Score 6.74
PubTator Score 6.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.200 3.7e-04
osteosarcoma 1.872 1.4e-07
atypical teratoid / rhabdoid tumor 1.200 6.9e-10
medulloblastoma, large-cell 1.300 2.4e-05
pancreatic ductal adenocarcinoma liver m... -1.215 2.7e-02
group 3 medulloblastoma 1.100 6.6e-04
subependymal giant cell astrocytoma 1.126 3.9e-02
ovarian cancer -1.100 4.3e-04

 MGI Phenotype (1)

Protein-protein Interaction (8)

Gene RIF (36)

PMID Text
26687946 Disruption of Snapin-PKR2 interaction did not affect PKR2 signaling, but increased the ligand-induced degradation, implying a role of Snapin in the trafficking of PKR2.
26608815 Prkar2a deficiency predisposes to hematopoietic malignancies in vivo. RIIalpha's likely association with HS and DLBCL was hitherto unrecognized and may lead to better understanding of these rare neoplasms.
26372733 High PK-R2 expression is associated with colorectal cancer.
25916936 we demonstrate that neurochondrin has strong isoform selectivity towards the RIIa subunit of PKA with nanomolar affinity
24755349 Results show that mouse Prkar1a and human PRKAR2A exhibited a dynamic spatio-temporal expression in tooth development, whereas neither human PRKAR1A nor mouse Prkar2a showed their expression in odontogenesis.
24753254 These data demonstrate that some Kallmann syndrome-associated, intracellularly retained mutant PKR2 receptors can be functionally rescued, suggesting a potential treatment strategy for patients bearing such mutations.
24189052 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
23942052 while there is no change in type II regulatory (RIIalpha) or catalytic (Calpha) subunit expression, site specific RIIalpha (Ser96) and Calpha (Thr197) phosphorylation are increased in heart failure, as well as expression of type I regulatory subunit (RI)
23362281 Smad4 and the R subunit of the protein kinase A holoenzyme form a functional complex in vivo in response to TGFbeta.
22808067 RIaalpha and RIIaalpha were identified as cCMP-binding proteins.
21651489 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
20708017 ETO nervy homology region (NHR) 3 domain-PKA(RIIalpha) protein interaction does not appear to significantly contribute to AML1-ETO's ability to induce leukemia.
20402410 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
20392842 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
20379146 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19895210 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
19367581 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19307216 Bacillus anthracis edema toxin altered the protein levels and activity of protein kinase A and exchange protein activated by cAMP (Epac), a recently identified cAMP-binding molecule.
18836454 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
17884635 RIIalpha releases Calpha upon elevated cAMP alone, dependent on autophosphorylation of the RIIalpha inhibitory domain
17494870 The data suggest that centrosomal anchoring of RIIalpha and the interrelated subapical positioning of these centrosomes is required for oncostatin M-, but not cAMP-mediated, bile canalicular lumen development.
17168834 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
17081989 The high-resolution crystal structures of the docking and dimerization (D/D) domain of the RIIalpha regulatory subunit of PKA in complex with the high-affinity anchoring peptide AKAP-IS explain the molecular basis for AKAP-regulatory subunit recognition.
16723498 These data implicate the involvement of PKA-RIIalpha anchoring apical targeting of distinct proteins and glycosphingolipids to apical plasma membrane domains and suggest that rerouting may underlie the delayed Golgi-to-apical surface transport of MDR1.
16394127 switching of PKA isozyme can cause tumor cells to undergo phenotypic reversion of the malignancy [revoew]
15629779 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
12972513 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
12727975 findings indicate that increased particulate type II protein kinase A activity occurs throughout pregnancy therefore directing the cAMP quiescence signal to specific subcellular loci within myometrial smooth muscle cells
9730685 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
9671211 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
9540970 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
9278385 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
9151826 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
7946090 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
7688126 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
1978848 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor

AA Sequence

MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLGHPPPEPGPDR      1 - 70
VADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIHPKTDEQRCRLQEACKDILLF     71 - 140
KNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELA    141 - 210
LMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEK    211 - 280
IYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAAS    281 - 350
AYAVGDVKCLVMDVQAFERLLGPCMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ                    351 - 404
//

Text Mined References (117)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26687946 2016 Snapin interacts with G-protein coupled receptor PKR2.
26608815 2015 Hematopoietic neoplasms in Prkar2a-deficient mice.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26372733 2015 Expression of prokineticin-receptor2(PK-R2) is a new prognostic factor in human colorectal cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25916936 2015 Neurochondrin is an atypical RII?-specific A-kinase anchoring protein.
24755349 2014 PKA regulatory subunit expression in tooth development.
24753254 2014 Functional rescue of Kallmann syndrome-associated prokineticin receptor 2 (PKR2) mutants deficient in trafficking.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24083380 2013 Differential PKA activation and AKAP association determines cell fate in cancer cells.
23942052 2013 Human heart failure is accompanied by altered protein kinase A subunit expression and post-translational state.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23362281 2013 Protein kinase A modulates transforming growth factor-? signaling through a direct interaction with Smad4 protein.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22808067 2012 Binding of regulatory subunits of cyclic AMP-dependent protein kinase to cyclic CMP agarose.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21812984 2011 The testis-specific C?2 subunit of PKA is kinetically indistinguishable from the common C?1 subunit of PKA.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21423175 2011 Control of PKA stability and signalling by the RING ligase praja2.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
20708017 2010 Structure of the AML1-ETO NHR3-PKA(RII?) complex and its contribution to AML1-ETO activity.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20379146 2010 Biological pathway-based genome-wide association analysis identified the vasoactive intestinal peptide (VIP) pathway important for obesity.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19367581 2010 Identification of neuroglycan C and interacting partners as potential susceptibility genes for schizophrenia in a Southern Chinese population.
19307216 2009 Bacillus anthracis edema toxin suppresses human macrophage phagocytosis and cytoskeletal remodeling via the protein kinase A and exchange protein activated by cyclic AMP pathways.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18088087 2008 Phosphoproteome of resting human platelets.
17911601 2007 Inhibition of T cell activation by cyclic adenosine 5'-monophosphate requires lipid raft targeting of protein kinase A type I by the A-kinase anchoring protein ezrin.
17884635 2007 Isoform-specific PKA dynamics revealed by dye-triggered aggregation and DAKAP1alpha-mediated localization in living cells.
17827149 2007 MyRIP anchors protein kinase A to the exocyst complex.
17494870 2007 Anchoring of protein kinase A-regulatory subunit IIalpha to subapically positioned centrosomes mediates apical bile canalicular lumen development in response to oncostatin M but not cAMP.
17487921 2007 Toward a global characterization of the phosphoproteome in prostate cancer cells: identification of phosphoproteins in the LNCaP cell line.
17081989 2006 Molecular basis of AKAP specificity for PKA regulatory subunits.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16807684 2006 Phosphoproteomic analysis of the human pituitary.
16723498 2006 Efficient trafficking of MDR1/P-glycoprotein to apical canalicular plasma membranes in HepG2 cells requires PKA-RIIalpha anchoring and glucosylceramide.
16642035 2006 An anchored PKA and PDE4 complex regulates subplasmalemmal cAMP dynamics.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16407073 2006 Dynamic binding of PKA regulatory subunit RI alpha.
16394127 2005 Tumor reversion: protein kinase A isozyme switching.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14966294 2004 A transforming growth factor beta-induced Smad3/Smad4 complex directly activates protein kinase A.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12727975 2003 Human myometrial quiescence and activation during gestation and parturition involve dramatic changes in expression and activity of particulate type II (RII alpha) protein kinase A holoenzyme.
12672969 2003 Bioinformatic design of A-kinase anchoring protein-in silico: a potent and selective peptide antagonist of type II protein kinase A anchoring.
12626323 2003 Glucagon and regulation of glucose metabolism.
12571360 2003 Protein kinase A-anchoring (AKAP) domains in brefeldin A-inhibited guanine nucleotide-exchange protein 2 (BIG2).
12509440 2003 Phosphoproteome analysis of capacitated human sperm. Evidence of tyrosine phosphorylation of a kinase-anchoring protein 3 and valosin-containing protein/p97 during capacitation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475942 2002 Characterization of an A-kinase anchoring protein in human ciliary axonemes.
12419802 2003 Endosome-to-Golgi transport is regulated by protein kinase A type II alpha.
12399526 Exogenous protein kinases A and C, but not endogenous prostasome-associated protein kinase, phosphorylate semenogelins I and II from human semen.
12186851 2002 Rab32 is an A-kinase anchoring protein and participates in mitochondrial dynamics.
12151104 2002 AMAP-1, a novel testis-specific AMY-1-binding protein, is differentially expressed during the course of spermatogenesis.
12080047 2002 The adenosine 2b receptor is recruited to the plasma membrane and associates with E3KARP and Ezrin upon agonist stimulation.
11886862 2002 Novel mechanism of regulation of Rac activity and lamellipodia formation by RET tyrosine kinase.
11823486 2002 Identification and characterization of myeloid translocation gene 16b as a novel a kinase anchoring protein in T lymphocytes.
11799244 2002 Requirement of a macromolecular signaling complex for beta adrenergic receptor modulation of the KCNQ1-KCNE1 potassium channel.
11696326 2001 Interaction of heterotrimeric G13 protein with an A-kinase-anchoring protein 110 (AKAP110) mediates cAMP-independent PKA activation.
11593431 2001 MTG8 proto-oncoprotein interacts with the regulatory subunit of type II cyclic AMP-dependent protein kinase in lymphocytes.
11557526 2001 Association of protein kinase A with AKAP150 facilitates pepsinogen secretion from gastric chief cells.
11414803 2001 Binding of PKA-RIIalpha to the Adenovirus E1A12S oncoprotein correlates with its nuclear translocation and an increase in PKA-dependent promoter activity.
11316952 Intracellular distribution of gravin, a PKA and PKC binding protein, in vascular endothelial cells.
11278869 2001 Identification of sperm-specific proteins that interact with A-kinase anchoring proteins in a manner similar to the type II regulatory subunit of PKA.
11102458 2000 Neurobeachin: A protein kinase A-anchoring, beige/Chediak-higashi protein homolog implicated in neuronal membrane traffic.
10993882 2000 Selectivity and regulation of A-kinase anchoring proteins in the heart. The role of autophosphorylation of the type II regulatory subunit of cAMP-dependent protein kinase.
10970852 2000 Scar/WAVE-1, a Wiskott-Aldrich syndrome protein, assembles an actin-associated multi-kinase scaffold.
10830164 2000 PKA phosphorylation dissociates FKBP12.6 from the calcium release channel (ryanodine receptor): defective regulation in failing hearts.
10799517 2000 Protein kinase A associates with cystic fibrosis transmembrane conductance regulator via an interaction with ezrin.
10764601 2000 Analysis of A-kinase anchoring protein (AKAP) interaction with protein kinase A (PKA) regulatory subunits: PKA isoform specificity in AKAP binding.
10601332 1999 The A-kinase-anchoring protein AKAP95 is a multivalent protein with a key role in chromatin condensation at mitosis.
10413680 1999 mAKAP: an A-kinase anchoring protein targeted to the nuclear membrane of differentiated myocytes.
10358086 1999 Characterization of a novel giant scaffolding protein, CG-NAP, that anchors multiple signaling enzymes to centrosome and the golgi apparatus.
10319321 1999 Isolation and molecular characterization of AKAP110, a novel, sperm-specific protein kinase A-anchoring protein.
10228048 1999 Diminished levels of protein kinase A RI alpha and RI beta transcripts and proteins in systemic lupus erythematosus T lymphocytes.
10026146 1999 PrKX is a novel catalytic subunit of the cAMP-dependent protein kinase regulated by the regulatory subunit type I.
9730685 HIV-1 tat molecular diversity and induction of TNF-alpha: implications for HIV-induced neurological disease.
9676433 1998 Mapping of the gene encoding the regulatory subunit RII alpha of cAMP-dependent protein kinase (locus PRKAR2A) to human chromosome region 3p21.3-p21.2.
9671211 1998 Human immunodeficiency virus Tat protein induces interleukin 6 mRNA expression in human brain endothelial cells via protein kinase C- and cAMP-dependent protein kinase pathways.
9506976 1998 A role for receptor kinases in the regulation of class II G protein-coupled receptors. Phosphorylation and desensitization of the secretin receptor.
9497389 1998 Molecular characterization of a cDNA that encodes six isoforms of a novel murine A kinase anchor protein.
9473338 1998 Molecular cloning, chromosomal localization, and cell cycle-dependent subcellular distribution of the A-kinase anchoring protein, AKAP95.
9380760 1997 Type II regulatory subunits are not required for the anchoring-dependent modulation of Ca2+ channel activity by cAMP-dependent protein kinase.
9326583 1997 D-AKAP2, a novel protein kinase A anchoring protein with a putative RGS domain.
9278385 1997 The Tat protein of HIV-1 induces tumor necrosis factor-alpha production. Implications for HIV-1-associated neurological diseases.
9151826 1997 The Nef protein of human immunodeficiency virus type 1 enhances serine phosphorylation of the viral matrix.
9065479 1997 Identification of a novel protein kinase A anchoring protein that binds both type I and type II regulatory subunits.
9003463 1997 Molecular cloning, upstream sequence and promoter studies of the human gene for the regulatory subunit RII alpha of cAMP-dependent protein kinase.
8621616 1996 Cloning and characterization of a novel A-kinase anchoring protein. AKAP 220, association with testicular peroxisomes.
8125992 1994 Cloning and characterization of AKAP 95, a nuclear protein that associates with the regulatory subunit of type II cAMP-dependent protein kinase.
8117614 1993 Differential expression of cyclic AMP-dependent protein kinase isozymes in normal human melanocytes and malignant melanomas.
7946090 1994 HIV Gag p17 protein impairs proliferation of normal lymphocytes in vitro.
7929081 1994 Type II regulatory subunit (RII) of the cAMP-dependent protein kinase interaction with A-kinase anchor proteins requires isoleucines 3 and 5.
7905481 1994 Type II regulatory subunits of cAMP-dependent protein kinase and their binding proteins in the nervous system of Aplysia californica.
7893490 1994 Differential localization of two isoforms of the regulatory subunit RII alpha of cAMP-dependent protein kinase in human sperm: biochemical and cytochemical study.
7688126 1993 Human immunodeficiency virus proteins induce the inhibitory cAMP/protein kinase A pathway in normal lymphocytes.
6293815 1982 Phosphorylation of the type-II regulatory subunit of cyclic-AMP-dependent protein kinase by glycogen synthase kinase 3 and glycogen synthase kinase 5.
2701845 1989 Localization and characterization of the binding site for the regulatory subunit of type II cAMP-dependent protein kinase on MAP2.
2561973 1989 The RII subunit of cAMP-dependent protein kinase binds to a common amino-terminal domain in microtubule-associated proteins 2A, 2B, and 2C.
2540040 1989 Human testis cDNA for the regulatory subunit RII alpha of cAMP-dependent protein kinase encodes an alternate amino-terminal region.
2165385 1990 cAMP-dependent protein kinase: framework for a diverse family of regulatory enzymes.
2147685 1990 Type II regulatory subunit dimerization determines the subcellular localization of the cAMP-dependent protein kinase.
1978848 1990 HIV inhibits the early steps of lymphocyte activation, including initiation of inositol phospholipid metabolism.
1618839 1992 Association of the type II cAMP-dependent protein kinase with a human thyroid RII-anchoring protein. Cloning and characterization of the RII-binding domain.
1544918 1992 Identification, purification, and characterization of subunits of cAMP-dependent protein kinase in human testis. Reverse mobilities of human RII alpha and RII beta on sodium dodecyl sulfate-polyacrylamide gel electrophoresis compared with rat and bovine RIIs.