Property Summary

NCBI Gene PubMed Count 27
PubMed Score 45.98
PubTator Score 16.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.100 9.7e-05

Gene RIF (18)

PMID Text
23396962 Low PRKAA2 expression is associated with follicular lymphoma.
21344388 Knockdown of SIRT1 by its inhibitor or siRNA results in Tat-mediated reduction of phosphorylation of AMP-activated protein kinase (AMPK) and downstream acetyl-CoA carboxylase (ACC)
20821366 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20473479 Through the enhancement of skeletal muscle glucose uptake and increased mitochondrial content, the R225W mutation of the gene encoding AMP-activated protein kinase (AMPK)gamma(3)may significantly enhance exercise performance.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19836452 Purification and characterization of truncated human AMPK alpha 2 beta 2 gamma 3 heterotrimer from baculovirus-infected insect cells
19720090 Knockdown of SIRT1 by its inhibitor or siRNA results in Tat-mediated reduction of phosphorylation of AMP-activated protein kinase (AMPK) and downstream acetyl-CoA carboxylase (ACC)
19574280 Variants in genes for AMPKalpha2 and AMPKgamma3 were not associated with PCOS or its component traits.
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17878938 identified for the first time a mutation in the skeletal muscle-specific regulatory gamma(3) subunit of AMPK in humans
17701023 Observational study of gene-disease association. (HuGE Navigator)
17701023 Genetic variability in PRKAG3 does not seem to have a major effect on glucose metabolism, but play a role in lipoprotein metabolism in humans.
17518971 data show that different mutations in gamma3 exert different effects on allosteric regulation of alpha2beta2gamma3 complex by AMP, whereas we find no evidence for their role in regulating the level of phosphorylation of alpha2 by upstream kinases.
16306365 role of the AMPKgamma3 isoform in exercise-induced metabolic and gene regulatory responses in skeletal muscle
14559719 the observation that the AMPKgamma3 isoform is expressed primarily in white skeletal muscle, in which it is the predominant gamma-isoform, strongly suggests that gamma3 has a key role in this tissue
10818001 Functional analysis of the pig counterpart.

AA Sequence

MEPGLEHALRRTPSWSSLGGSEHQEMSFLEQENSSSWPSPAVTSSSERIRGKRRAKALRWTRQKSVEEGE      1 - 70
PPGQGEGPRSRPAAESTGLEATFPKTTPLAQADPAGVGTPPTGWDCLPSDCTASAAGSSTDDVELATEFP     71 - 140
ATEAWECELEGLLEERPALCLSPQAPFPKLGWDDELRKPGAQIYMRFMQEHTCYDAMATSSKLVIFDTML    141 - 210
EIKKAFFALVANGVRAAPLWDSKKQSFVGMLTITDFILVLHRYYRSPLVQIYEIEQHKIETWREIYLQGC    211 - 280
FKPLVSISPNDSLFEAVYTLIKNRIHRLPVLDPVSGNVLHILTHKRLLKFLHIFGSLLPRPSFLYRTIQD    281 - 350
LGIGTFRDLAVVLETAPILTALDIFVDRRVSALPVVNECGQVVGLYSRFDVIHLAAQQTYNHLDMSVGEA    351 - 420
LRQRTLCLEGVLSCQPHESLGEVIDRIAREQVHRLVLVDETQHLLGVVSLSDILQALVLSPAGIDALGA     421 - 489
//

Text Mined References (32)

PMID Year Title
23396962 2013 Association of AMP-activated protein kinase with risk and progression of non-Hodgkin lymphoma.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21460634 2011 Ulk1-mediated phosphorylation of AMPK constitutes a negative regulatory feedback loop.
20821366 2011 Association study of energy homeostasis genes and antipsychotic-induced weight gain in patients with schizophrenia.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20473479 2010 Naturally occurring R225W mutation of the gene encoding AMP-activated protein kinase (AMPK)gamma(3) results in increased oxidative capacity and glucose uptake in human primary myotubes.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19836452 2010 Purification and characterization of truncated human AMPK alpha 2 beta 2 gamma 3 heterotrimer from baculovirus-infected insect cells.
19574280 2009 Association study of AMP-activated protein kinase subunit genes in polycystic ovary syndrome.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18439900 2008 AMPK phosphorylation of raptor mediates a metabolic checkpoint.
17878938 2007 Gain-of-function R225W mutation in human AMPKgamma(3) causing increased glycogen and decreased triglyceride in skeletal muscle.
17712357 2007 AMP-activated/SNF1 protein kinases: conserved guardians of cellular energy.
17701023 2007 Role of AMP-activated protein kinase gamma 3 genetic variability in glucose and lipid metabolism in non-diabetic whites.
17518971 2007 Regulation of the muscle-specific AMP-activated protein kinase alpha2beta2gamma3 complexes by AMP and implications of the mutations in the gamma3-subunit for the AMP dependence of the enzyme.
17307971 2007 AMP-activated protein kinase in metabolic control and insulin signaling.
17255938 2007 Regulation of AMP-activated protein kinase by a pseudosubstrate sequence on the gamma subunit.
16306365 2005 Changes in exercise-induced gene expression in 5'-AMP-activated protein kinase gamma3-null and gamma3 R225Q transgenic mice.
16054041 2005 AMP-activated protein kinase: ancient energy gauge provides clues to modern understanding of metabolism.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15203218 2004 Circular rapid amplification of cDNA ends for high-throughput extension cloning of partial genes.
14970697 2003 Comparative sequence analysis of the PRKAG3 region between human and pig: evolution of repetitive sequences and potential new exons.
14722619 2004 CBS domains form energy-sensing modules whose binding of adenosine ligands is disrupted by disease mutations.
14651849 2003 TSC2 mediates cellular energy response to control cell growth and survival.
14559719 2004 Expression profiling of the gamma-subunit isoforms of AMP-activated protein kinase suggests a major role for gamma3 in white skeletal muscle.
14503854 2003 A large-insert porcine library with sevenfold genome coverage: a tool for positional cloning of candidate genes for major quantitative traits.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12391032 2003 5'-AMP-activated protein kinase activity and subunit expression in exercise-trained human skeletal muscle.
10818001 2000 A mutation in PRKAG3 associated with excess glycogen content in pig skeletal muscle.
10698692 2000 Characterization of AMP-activated protein kinase gamma-subunit isoforms and their role in AMP binding.
8626596 1996 Characterization of AMP-activated protein kinase beta and gamma subunits. Assembly of the heterotrimeric complex in vitro.