Property Summary

NCBI Gene PubMed Count 56
PubMed Score 20.97
PubTator Score 13.20

Knowledge Summary

Patent (3,567)

Expression

  Differential Expression (28)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.822 2.8e-03
chronic lymphocytic leukemia -2.839 6.7e-06
malignant mesothelioma -1.400 2.0e-05
astrocytoma -2.100 2.7e-03
ependymoma -2.100 7.6e-03
oligodendroglioma -1.400 1.6e-09
cutaneous lupus erythematosus 1.400 1.9e-02
psoriasis -1.300 6.2e-03
glioblastoma -1.700 5.2e-03
osteosarcoma -1.828 2.2e-07
sonic hedgehog group medulloblastoma -1.500 1.1e-06
atypical teratoid / rhabdoid tumor -2.100 2.0e-06
medulloblastoma, large-cell -2.500 2.1e-06
primitive neuroectodermal tumor -1.300 2.8e-04
Crohn's disease -1.747 5.7e-03
ulcerative colitis -2.083 3.7e-04
Duchenne muscular dystrophy 1.063 2.7e-07
primary pancreatic ductal adenocarcinoma 1.170 5.8e-03
colon cancer -3.000 8.9e-03
Parkinson's disease -1.700 1.9e-02
sarcoidosis 1.400 3.0e-02
pediatric high grade glioma -1.300 2.8e-05
aldosterone-producing adenoma -1.036 4.2e-02
lung carcinoma 2.000 1.8e-27
Pick disease -1.300 1.4e-02
ovarian cancer -2.600 6.7e-11
Down syndrome 1.200 2.4e-02
pancreatic cancer 1.200 5.1e-03

 GWAS Trait (1)

MLP Assay (6)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
504700 screening 273 / 0 / 343427 Fluorescence polarization-based biochemical primary high throughput screening assay to identify activators of the Protein Kinase A-R2B (PKA-R2B) complex
504796 screening 17 / 0 / 253 Counterscreen for activators of the Protein Kinase A-R2B (PKA-R2B) complex: fluorescence polarization-based biochemical high throughput screening assay to identify fluorescence polarization assay artifacts
504797 screening 25 / 0 / 245 Fluorescence polarization-based biochemical high throughput confirmation assay for activators of the Protein Kinase A-R2B (PKA-R2B) complex
504888 confirmatory 7 / 0 / 4 Fluorescence polarization-based biochemical high throughput dose response assay for activators of the Protein Kinase A-R2B (PKA-R2B) complex
504893 confirmatory 7 / 0 / 1 Counterscreen for activators of the Protein Kinase A-R1A (PKA-R1A) complex: fluorescence polarization-based biochemical high throughput dose response assay to identify activators of the Protein Kinase A-R2B (PKA-R2B) complex

Gene RIF (42)

PMID Text
25831493 analysis of the mechanism underlying synergistic up-regulation of PDE4B2 via a cross-talk between PKA-Cbeta and p65
24294386 The gene polymorphism loci rs12132032 in PRKACB maybe a potential risk factor for anencephaly in Chinese population from Shanxi, while gender susceptibility may influence the correlation.
24189052 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
22114277 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
21745501 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
21651489 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
20564261 The previously unknown small molecule inhibitor-dependent interaction of Cbeta1 with the cell cycle and apoptosis regulatory protein-1 was verified.
20433920 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
20402410 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
20392842 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
20379146 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20093341 PGE(2)-induced CYP1B1 expression is mediated by ligand-independent activation of the ERalpha pathway as a result of the activation of ERK, Akt, and PKA in breast cancer cells.
20086095 Data show that PI3K activation and PIP3 production lead to recruitment of the PKB/beta-arrestin/PDE4 complex to the membrane via the PKB PH domain, resulting in degradation of the TCR-induced cAMP pool and allowing full T-cell activation to proceed.
20033853 activated by podophyllotoxin
19965870 Data show that Phosphorylation of The(197) in the activation loop on protein kinase A decreased the K(m) by approximately 15- and 7-fold for kemptide and ATP, respectively.
19895210 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
19711044 Results suggest that PKA can negatively regulate ERalpha, at least in part, through FoxH1.
19573263 Report expression of protein kinase A and C subunits in post-mortem prefrontal cortex from persons with major depression and normal controls.
19483721 Findings show that PKIB and PKA-C kinase can have critical functions of aggressive phenotype of PCs through Akt phosphorylation and that they should be a promising molecular target for PC treatment.
19383776 In human primary pigmented nodular adrenocortical disease tissues, dexamethasone paradoxically stimulates cortisol release through a glucocorticoid receptor-mediated effect on PKA catalytic subunits.
19100722 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
18836454 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
18499756 Recruitment of coactivator glucocorticoid receptor interacting protein 1 to an estrogen receptor transcription complex is regulated by the 3',5'-cyclic adenosine 5'-monophosphate-dependent protein kinase.
17594903 Nuclear PKA C subunit co-locates with HA95 in splicing factor compartments and regulates pre-mRNA splicing, possibly through a cAMP-independent mechanism.
17549442 Data provide the first evidence that Protein kinase C -beta play pivotal role in the regulation of AA production and cellular proliferation of human monocytoid MonoMac-6 cells.
16949795 In conclusion, it seems that the Cbeta isoforms of PKA play different roles in proliferation and differentiation and could therefore be potential markers for prostate cancer progression.
16889664 Murine lymphoid tissues express a protein that is a homologue of human protein kinase c subunit beta2
15723830 there is a PKA-Cbeta-mediated inhibitory mechanism of p73 function
15629779 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
14744463 there are abnormalities in [3H]cAMP binding and catalytic activity kinase A in brain of depressed suicide victims, which could be due to reduced expression of RIIbeta and Cbeta.
12972513 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
12842892 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
12682012 Data describe the identification of a variant of the beta catalytic subunit of cyclic AMP-dependent protein kinase (PKACbeta) as a p75 neurotrophin receptor(NTR)-interacting protein, which phosphorylates p75(NTR) at Ser304.
12420224 c-MYC induces the activity of protein kinase A by inducing the transcription of the gene encoding the PKA catalytic subunit beta in multiple tissues, independent of cell proliferation by direct binding of c-MYC to promoter sequences.
9730685 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
9671211 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
9540970 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
9278385 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
9151826 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
7946090 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
7688126 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor
1978848 HIV-1 MA increases phosphorylation and the DNA-binding activity of CREB and c-Myc through activation of the cAMP/PKA and MEK/ERK signaling pathways. Both signaling pathways are synergistically activated upon co-stimulation through the CD19 receptor

AA Sequence

MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYY      1 - 70
AMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFS     71 - 140
EPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEI    141 - 210
ILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTK    211 - 280
RFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAPFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGE    281 - 350
F//

Text Mined References (62)

PMID Year Title
25831493 2015 Cross-talk between PKA-C? and p65 mediates synergistic induction of PDE4B by roflumilast and NTHi.
25416956 2014 A proteome-scale map of the human interactome network.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24294386 2013 Association between PKA gene polymorphism and NTDs in high risk Chinese population in Shanxi.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23001122 2012 Genome-wide association study identifies a common variant in RAD51B associated with male breast cancer risk.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
21880142 2011 G-patch domain and KOW motifs-containing protein, GPKOW; a nuclear RNA-binding protein regulated by protein kinase A.
21423175 2011 Control of PKA stability and signalling by the RING ligase praja2.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21269460 2011 Initial characterization of the human central proteome.
20564261 2010 Uncoupling of bait-protein expression from the prey protein environment adds versatility for cell and tissue interaction proteomics and reveals a complex of CARP-1 and the PKA Cbeta1 subunit.
20379146 2010 Biological pathway-based genome-wide association analysis identified the vasoactive intestinal peptide (VIP) pathway important for obesity.
20093341 2010 Prostaglandin E2 induces CYP1B1 expression via ligand-independent activation of the ERalpha pathway in human breast cancer cells.
20086095 2010 Cross talk between phosphatidylinositol 3-kinase and cyclic AMP (cAMP)-protein kinase a signaling pathways at the level of a protein kinase B/beta-arrestin/cAMP phosphodiesterase 4 complex.
20033853 2010 Podophyllotoxin induces CREB phosphorylation and CRE-driven gene expression via PKA but not MAPKs.
19965870 2010 Global consequences of activation loop phosphorylation on protein kinase A.
19711044 2009 PKA-mediated stabilization of FoxH1 negatively regulates ERalpha activity.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19573263 2009 Protein kinases A and C in post-mortem prefrontal cortex from persons with major depression and normal controls.
19483721 2009 Overexpressing PKIB in prostate cancer promotes its aggressiveness by linking between PKA and Akt pathways.
19383776 2009 The paradoxical increase in cortisol secretion induced by dexamethasone in primary pigmented nodular adrenocortical disease involves a glucocorticoid receptor-mediated effect of dexamethasone on protein kinase A catalytic subunits.
19197368 2009 Ser276 phosphorylation of NF-kB p65 by MSK1 controls SCF expression in inflammation.
18499756 2008 Recruitment of coactivator glucocorticoid receptor interacting protein 1 to an estrogen receptor transcription complex is regulated by the 3',5'-cyclic adenosine 5'-monophosphate-dependent protein kinase.
18385332 2008 Protein kinase A-induced phosphorylation of the p65 subunit of nuclear factor-kappaB promotes Schwann cell differentiation into a myelinating phenotype.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17594903 2007 Involvement of the catalytic subunit of protein kinase A and of HA95 in pre-mRNA splicing.
17549442 2007 Protein kinase C-beta and -delta isoenzymes promote arachidonic acid production and proliferation of MonoMac-6 cells.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16949795 2007 Androgen dependent regulation of protein kinase A subunits in prostate cancer cells.
16889664 2006 Identification, cloning and characterization of a novel 47 kDa murine PKA C subunit homologous to human and bovine Cbeta2.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16407073 2006 Dynamic binding of PKA regulatory subunit RI alpha.
16381901 2006 The LIFEdb database in 2006.
15723830 2005 Identification of protein kinase A catalytic subunit beta as a novel binding partner of p73 and regulation of p73 function.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14744463 2004 Protein kinase A in postmortem brain of depressed suicide victims: altered expression of specific regulatory and catalytic subunits.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12842892 2003 Active cAMP-dependent protein kinase incorporated within highly purified HIV-1 particles is required for viral infectivity and interacts with viral capsid protein.
12798691 2003 Mutants of protein kinase A that mimic the ATP-binding site of protein kinase B (AKT).
12682012 2003 PKA phosphorylates the p75 receptor and regulates its localization to lipid rafts.
12628924 2003 Transcriptional activation of the NF-kappaB p65 subunit by mitogen- and stress-activated protein kinase-1 (MSK1).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12420224 2002 c-MYC activates protein kinase A (PKA) by direct transcriptional activation of the PKA catalytic subunit beta (PKA-Cbeta) gene.
11589697 2001 Identification of novel splice variants of the human catalytic subunit Cbeta of cAMP-dependent protein kinase.
11172053 2001 The effects of aging on gene expression in the hypothalamus and cortex of mice.
11076863 2000 DNA cloning using in vitro site-specific recombination.
9730685 HIV-1 tat molecular diversity and induction of TNF-alpha: implications for HIV-induced neurological disease.
9671211 1998 Human immunodeficiency virus Tat protein induces interleukin 6 mRNA expression in human brain endothelial cells via protein kinase C- and cAMP-dependent protein kinase pathways.
9636365 1998 The cAMP-dependent protein kinase A and protein kinase C-beta pathways synergistically interact to activate HIV-1 transcription in latently infected cells of monocyte/macrophage lineage.
9278385 1997 The Tat protein of HIV-1 induces tumor necrosis factor-alpha production. Implications for HIV-1-associated neurological diseases.
9151826 1997 The Nef protein of human immunodeficiency virus type 1 enhances serine phosphorylation of the viral matrix.
8662989 1996 The major catalytic subunit isoforms of cAMP-dependent protein kinase have distinct biochemical properties in vitro and in vivo.
7688126 1993 Human immunodeficiency virus proteins induce the inhibitory cAMP/protein kinase A pathway in normal lymphocytes.
7684369 1993 Evidence for two additional isoforms of the endogenous protein kinase inhibitor of cAMP-dependent protein kinase in mouse.
2342480 1990 Molecular cloning of a tissue-specific protein kinase (C gamma) from human testis--representing a third isoform for the catalytic subunit of cAMP-dependent protein kinase.
2165385 1990 cAMP-dependent protein kinase: framework for a diverse family of regulatory enzymes.
1551670 1992 Assignment of the gene encoding the catalytic subunit C beta of cAMP-dependent protein kinase to the p36 band on chromosome 1.