Property Summary

NCBI Gene PubMed Count 442
PubMed Score 9.59
PubTator Score 163.77

Knowledge Summary

Patent (4,564)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.100 8.4e-03
group 3 medulloblastoma -1.500 3.2e-03

MLP Assay (5)

AID Type Active / Inconclusive / Inactive Description
524 screening 94 / 0 / 64831 Primary biochemical high-throughput screening assay for inhibitors of protein kinase A (PKA) activity
548 confirmatory 62 / 0 / 32 Dose-response biochemical assay for inhibitors of protein kinase A (PKA) activity
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
504583 confirmatory 3 / 1 / 25 Protein Kinase A Activity Assay Measured in Biochemical System Using Plate Reader - 2052-04_Inhibitor_Dose_DryPowder_Activity
588629 confirmatory 6 / 6 / 70 Protein Kinase A Activity Assay Measured in Biochemical System Using Plate Reader - 2052-04_Inhibitor_Dose_DryPowder_Activity_Set2

Gene RIF (191)

PMID Text
26978032 Our results reveal for the first time the role of the versatile PKA in cancer cells survival under chronic glucose starvation and anoikis and may be a novel potential target for cancer treatment.
26701869 No somatic mutations were observed in PRKACA in a cohort of GH-secreting pituitary adenomas.
26669444 Data show that activated PKA phosphorylates the 19S subunit, Rpn6/PSMD11 (regulatory particle non-ATPase 6/proteasome subunit D11) at Ser14.
26505878 DNAJB1-PRKACA was evaluated as a key driver of fibrolamellar carcinoma and as a candidate therapeutic target
26435498 Akt and PKA phosphorylated KLHL3 at S433, and phosphorylation of KLHL3 by PKA inhibited WNK4 degradation.
26387949 PKA phosphorylates the ATPase inhibitory factor 1 and inactivates its capacity to bind and inhibit the mitochondrial H(+)-ATP synthase.
26358293 Data indicate that protein kinase A (PKA) phosphorylates only serine-253 amino acid on activator of G-protein signaling 1 protein Dexras1 (RASD1).
26258546 Protein kinase A activity is necessary for fission and fusion of Golgi to endoplasmic reticulum retrograde tubules.
26052940 Kapbeta2 interacts with ULK2 through ULK2's putative PY-NLS motif, and facilitates transport from the cytoplasm to the nucleus, depending on its Ser1027 residue phosphorylation by PKA, thereby reducing autophagic activity.
25951193 ITM2A expression is positively regulated by PKA-CREB signaling and ITM2A expression interferes with autophagic flux by interacting with vacuolar ATPase.
25913012 association of ezrin with the actin cytoskeleton and phosphorylation on Thr567 are required, but not sufficient, for PKA and EPAC1 to synergistically promote cell spreading following elevations in intracellular cAMP.
25775607 analysis of how the conformational dynamics of protein kinase A induced by a lethal mutant of phospholamban hinder phosphorylation
25750087 PRKACAL206R is present not only in adenomas, but also in unilateral hyperplasia and is associated with more severe autonomous cortisol secretion.
25653177 These findings suggest that C18orf42 may be a novel PKA signaling gene that serves as an endogenous disruptor peptide for PKA-AKAP interactions.
25575591 Data show that silencing ezrin-radixin-moesin (ERM) protein expression ablates deleted in colorectal carcinoma protein (DCC)-protein kinase A (PKA) interaction and specifically blocks netrin-induced PKA activity and phosphorylation.
25557953 In this cohort of fibrolamellar hepatocellular carcinoma, almost 80% contained the DNAJB1-PRKACA fusion transcript.
25477193 Leu206Arg and Leu199_Cys200insTrp mutations in PRKACA impair its association with PRKAR2B and PRKAR1A.
25449630 Case Reports: pathologic findings for patients with germline copy number gain of PRKACA and Cushing syndrome.
25225481 It is unlikely that mutation at PRKACA locus is involved in the pathogenesis of sporadic somatotroph adenoma; however, gene amplification or mutations at other loci or in other components of the cAMP signalling pathway cannot be ruled out.
25213315 Its signaling pathway is associated with the progression and prognosis of colorectal neoplasms.
25188285 PKA compartmentalization via AKAP220 and AKAP12 contributes to endothelial barrier regulation.
25109834 PKA phosphorylation of CREB was involved in the EP4 receptor-mediated PGE2 upregulation of c-Myc in hepatocellular carcinoma.
25069672 Of the 13 patients with Cortisol Producing Adenomas who showed overt Cushing's syndrome, 3 (23%) had recurrent somatic mutations of the PRKACA gene, p.L206R (c.617 T>G), and there were no mutations in subclinical Cushing's syndrome.
25057884 These data confirm and extend previous observations that somatic PRKACA mutations are specific for adrenocortical adenomas causing Cushing's syndrome.
25037568 KCNE1 distal C-terminus appears essential for the regulation of yotiao-mediated PKA phosphorylation.
24909179 this study discovered that expression of the survival kinases PRKACA and PIM1 rescued cells from anti-HER2 therapy.
24855271 The L206R PRKACA mutant abolished its binding to the regulatory subunit of (cAMP)-dependent protein kinase (PKA) (PRKAR1A) that inhibits catalytic activity of PRKACA, leading to constitutive, cAMP-independent PKA activation in corticotropin-independent Cushing's syndrome.
24813785 AKAP 149-PKA-PDE4A complex localization is related with YTX effect in K-562 cell line
24747643 recurrent gain-of-function mutation in PRKACA in cortisol-producing adrenal adenomas
24733293 These results demonstrate that glucagon increases hepatic FGF21 secretion via a posttranscriptional mechanism and provide evidence that both the PKA branch and EPAC branch of the cAMP pathway play a role in mediating this effect.
24700472 this study identified a hotspot in the PRKACA gene with a L205R mutation in 69.2% (27 out of 39) of cortisol-producing adrenocortical adenomas (ACAs) and validated in 65.5% of a total of 87 ACAs.
24627100 visfatin modulates glucose production in HepG2 cells through the PKA/CREB pathway, rather than via SIRT1 signaling.
24578576 Evidence supporting the presence of the DNAJB1-PRKACA chimeric transcript in 100% of the FL-HCCs examined (15/15) suggests that this genetic alteration contributes to tumor pathogenesis.
24571724 Genetic alterations of the catalytic subunit of PKA were found to be associated with bilateral adrenal hyperplasias and unilateral cortisol-producing adrenal adenomas.
24389246 These results show involvement of PKA, CREB and PGC-1alpha in the regulation of OXPHOS in cell transition from the replicating to the quiescent state.
24344931 These results indicate that HIV-1-associated PKA is required for early reverse transcription of the retroviral genome both in cell free intact viruses and in target cells.
24282540 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells
24192058 Interleukin 33 has a role in enhancing the p38 MAPK and PKA signaling pathways in melanocytes
24189052 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells
24140250 Data show that cAMP/alpha isoform of the catalytic subunit of human PKA (PKAc-alpha) signaling can disrupt microtubule (MT) cytoskeleton by the phosphorylation of microtubule-Associated Protein 4 (MAP4).
24037441 Activation of PKA catalytic subunits promoted splicing factor SC35-mediated tau exon 10 inclusion.
24028560 This study is the first to demonstrate subversion of host cAMP-dependent protein kinase activity by the intracellular bacterial pathogen Coxiella burnetii to prevent apoptosis and survive within macrophages.
23942052 while there is no change in type II regulatory (RIIalpha) or catalytic (Calpha) subunit expression, site specific RIIalpha (Ser96) and Calpha (Thr197) phosphorylation are increased in heart failure, as well as expression of type I regulatory subunit (RI)
23806656 Comparative analysis of the binding responses of mutations to mAKAP could provide important information about how these mutations modulate PKA and PDE4D3 signaling.
23797058 the inhibitory effect of cAMP on migration, ruffling, focal adhesion dynamics and paxillin localisation is mediated by PKA, whilst EPAC potentiates migration.
23504319 PKA is a regulator of MYC; its different catalytic subunits have distinct biologcial roles
23410945 the PKA pathway is functionally linked to androgen receptor in the progression of prostate cancer
23341462 Data suggest that cross-talk occurs between cAMP/PKA and the IL-2R beta/Jak3/Stat5b cascade in T-cells.
23245330 Data indicate inhibition of cAMP-dependent protein kinase A with H89 partially reverted resistance of NB4.437r cells to ST1926.
23220172 We conclude that the effects of selenoprotein H on mitochondrial biogenesis and mitochondrial function are probably mediated through protein kinase A-CREB-PGC-1alpha and Akt/protein kinase B-CREB-PGC-1alpha pathways.
23074279 Data show that TIMP-2-mediated inhibition of vascular endothelial cell permeability involves an integrin alpha3beta1-Shp-1-cAMP/protein kinase A-dependent vascular endothelial cadherin cytoskeletal association.
22926037 High CB1 and PKA expression is associated with low survival intracellular pathway activation and high iNOS activation in ischemic heart disease patients.
22908311 PKA-phosphodiesterase(PDE)4D3-A kinase anchor protein (AKAP)9 complex generates spatial compartmentalization of cyclic adenosine monophosphate (cAMP) signaling at the centrosome.
22750392 Glucagon-like peptide-1 inhibits angiotensin II-induced mesangial cell damage via protein kinase A
22728165 In prostate cancer cells, S100A8 expression is stimulated by prostaglandin E2 via EP2 and EP4 receptors through activation of the protein kinase A signaling pathway and stimulation of CCAAT/enhancer-binding-protein-beta binding to the S100A8 promoter.
22669896 genistein may play a beneficial role in vascular function through targeting the PKA/CREB/eNOS/NO signaling pathway
22609331 The effect of norepinephrine on amyloid beta(1-42) peptide-induced responses in migroglia-like THP-1 cells is contingent on cyclic AMP/PKA pathways and cAMP responsive element binding protein (CREB) activation.
22561749 Data show that the cAMP/PKA/CREB signaling pathway initiates acidosis-induced V-ATPase trafficking in salivary ducts via regulation of Rab11b expression.
22553202 Data indicate that an increase in cAMP/PKA activity resulted in the dissociation of SIRT1 and DBC1 in an AMP-activated protein kinase (AMPK)-dependent manner.
22504716 Findings indicate that Calpha2 through the hydrophobic pocket has the ability to bind intracellular targets in the sperm cell, which may modulate protein stability, activity and/or cellular localization.
22479536 Activation of protein kinase A and exchange protein directly activated by cAMP promotes adipocyte differentiation of human mesenchymal stem cells
22452847 The protein kinase A pathway enhance ipopolysaccharide-induced IL-6, IL-8, and prostaglandin Eproduction by human gingival fibroblasts.
22433860 Data show that protein kinase A (PKA) phosphorylation has a drastic impact on Na(+)/K(+)-ATPase (NKA) structure and dynamics.
22384111 Histamine derived from probiotic Lactobacillus reuteri suppresses TNF via modulation of PKA and ERK signaling
22363678 Cigarette smoke extract decreased Epac1 expression, but did not affect Epac2 and PKA expression.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22272352 Results show that induction of RhoE by cAMP is mediated through protein kinase A (PKA) and promotes BeWo cell fusion but has no effect on functional differentiation.
22132070 Abnormality in beta-adrenergic-PKA signaling may contribute to cardiomyopathy and heart failure through dysregulation in the alternative splicing of CaMKIIdelta exons 14, 15, and 16 and up-regulation of CaMKIIdeltaC.
22114277 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells
21957496 Data show that protein kinase A (PKA) regulates the alternative splicing of Ca(2)/calmodulin-dependent protein kinase kinase 2 (CaMKK2) to produce variants that differentially modulate neuronal differentiation.
21835884 Occlusion of PKA-dependent processes is one of the molecular mechanisms underlying cognitive decline in Huntington disease.
21812984 N-terminal sequence encoded by alternative use of exons upstream of exon 2 in the PRKACA gene does not influence C subunit activities such as holoenzyme formation, cAMP sensitivity
21745501 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells
21651489 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells
21559296 analysis of a novel TGFbeta/PKA tumor suppressor pathway that acts directly on a known cell survival mechanism that responds to stress with the survivin/XIAP dependent inhibition of caspases that effect apoptosis
21536683 Protein kinase A activity at the endoplasmic reticulum surface is responsible for augmentation of human ether-a-go-go-related gene product (HERG)
21514275 The regulation of RORalpha activity by PKA as well as CaMK-IV provides a new link in the signalling network that regulates metabolic processes such as glycogen and lipid metabolism.
21461565 The results revealed that, in SGC-7901 cells, soluble fibronectin increased RhoA activity and blocked the inhibition of RhoA activity by cAMP/PKA.
21367856 down-regulation of PKA dysregulates the alternative splicing of tau exon 10 and contributes to neurofibrillary degeneration in Alzheimer disease by causing an imbalance in 3R-tau and 4R-tau expression
21357689 cAMP-dependent protein kinase is responsible for the phosphorylation of the terminal serine in both K(2P)3.1 and K(2P)9.1
21209912 ciliary localization of Sufu is dependent on ciliary-localized Gli proteins, and is inhibited by PKA activation
21098703 Findings show a connection between PKA activity and GJIC mediated by PI3K-independent mechanisms.
21085490 Findings of PKA regulation of HSF1 through S320 phosphorylation show the signaling networks converging on this factor and may contribute to elucidating its complex roles in the stress response and understanding HSF1 dysregulation in disease.
21075212 The present study delineates the fundamental elements of a core promoter structure that will be helpful for future studies regarding the regulation of RAB25 gene.
20849292 This review discusses the different characteristics of regulating the activity and subcellular localization of MK5 and RSK1 by PKA and the functional implications of these interactions.
20732331 The crystal structures demonstrate that, in accord with the previously reported bisubstrate character of adenosine analogue-oligoarginine conjugates, the inhibitors occupy both binding sites of the catalytic subunit alpha of cAMP-dependent protein kinase.
20716686 Findings identify HDAC5 as a substrate of PKA and reveal a cAMP/PKA-dependent pathway that controls HDAC5 nucleocytoplasmic shuttling and represses gene transcription.
20664056 These data reveal a new role for TSP-1 in promoting platelet aggregation through modulation of the cAMP-PKA signaling pathway.
20501673 Data hypothesize that VEGFR-2 forms a signaling complex with S1P(1) and and protein kinase C-alpha , evoking bidirectional signaling regulating both ERK1/2 phosphorylation and haptotaxis of ML-1 cells.
20484458 cAMP induces leptin expression in placental cells and that this effect seems to be mediated by a cross talk between PKA and MAPK signaling pathways.
20433920 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells
20402410 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells
20392842 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells
20356841 Thrombin and collagen induce a feedback inhibitory signaling pathway in platelets involving dissociation of the catalytic subunit of protein kinase A from an NFkappaB-IkappaB complex
20209159 analysis of evolutionary conserved residues that are crucial for the catalytic activity of PKA and Pak2
20159975 OATP2B1/SLCO2B1 function is modulated by protein kinase C-mediated internalization
20045463 These data demonstrate that PKA phosphorylation of Kv4.2 plays an important role in the trafficking of Kv4.2 through its specific interaction with KChIP4a.
19965870 Data show that Phosphorylation of The(197) in the activation loop on protein kinase A decreased the K(m) by approximately 15- and 7-fold for kemptide and ATP, respectively.
19949837 These results indicate that high glucose can increase adipogenic and inhibit osteogenic differentiation by activating cAMP/PKA/ERK pathway in MG-63 cells.
19923321 These results highlight serines 11 and 92 as new players in Snail1 regulation and suggest the participation of CK2 and PKA in the modulation of Snail1 functionality.
19920112 Protein kinase A activation confers resistance to trastuzumab in human breast cancer cell lines
19895210 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells
19808666 Findings demonstrate that interactions between endogenous RSK1 and PKAc in intact cells regulate the ability of cAMP to activate PKA and identify a novel mechanism by which PKA activity is regulated by the Erk1/2 pathway.
19789307 NF-kappaB p65 (Ser276) phosphorylation by PKA promotes the malignant phenotype and holds potential as a therapeutic target in HNSCC.
19755416 hepatic serum amyloid A expression is enhanced via protein kinase A-dependent mechanism
19711044 Results suggest that PKA can negatively regulate ERalpha, at least in part, through FoxH1.
19692500 CD9 increases GCM1 expression via the cAMP/PKA signaling pathway, resulting in the increase in ERVWE1 expression.
19667072 Lfc is a phosphorylated protein and demonstrate that 14-3-3 interacts directly and in a phosphorylation-dependent manner with Lfc.
19647741 Data suggest that the state of tau3 phosphorylation by protein kinase A affects the mode of 14-3-3zeta binding and by this means might modify tau filament formation.
19618297 Activation of TR4 orphan nuclear receptor gene promoter by cAMP/PKA and C/EBP signaling.
19573263 Report expression of protein kinase A and C subunits in post-mortem prefrontal cortex from persons with major depression and normal controls.
19483721 Findings show that PKIB and PKA-C kinase can have critical functions of aggressive phenotype of PCs through Akt phosphorylation and that they should be a promising molecular target for PC treatment.
19403523 In PKA the ligand selectivity is controlled mainly at the level of ligand affinity.
19383776 In human primary pigmented nodular adrenocortical disease tissues, dexamethasone paradoxically stimulates cortisol release through a glucocorticoid receptor-mediated effect on PKA catalytic subunits.
19368997 catalytic subunits level of PKA inhibit angiogenesis
19264843 cAMP/PKA signaling enhances ERRalpha phosphorylation and nuclear localization, recruitment to the SP-A promoter, and interaction with PKAcat and SRC-2, resulting in the up-regulation of SP-A gene transcription.
19210988 Data show that PKC activation resulted in redistribution of gravin and PKA constructs to the same subcellular site, and suggest that this response to PKC activity may mediate PKC dependent control of PKA activity.
19100722 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells
19018281 PKA activates human HSL against lipid substrates in vitro primarily through phosphorylation of Ser649 and Ser650
18953413 HPV16 E7-dependent transformation activates NHE1 through a PKA-RhoA-induced inhibition of p38alpha.
18836454 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells
18728186 The distribution of DNA-PK between nuclear and cytoplasmic compartments can thus potentially be influenced by relative inputs of cAMP signaling through the EPAC and PKA pathways.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18505929 growth factor signals promote phosphorylation of ER coactivator PELP1 via PKA pathway, and such modification may have functional implications in breast tumors with deregulated growth factor signaling
18490653 activation of protein kinase A elicits an immediate response through induction of genes such as ID2 and FosB, followed by sustained secretion of bone-related cytokines such as BMP-2, IGF-1, and IL-11
18451148 Androgen actively evokes a nongenomic signaling pathway to activate PKA that is needed for the genomic functioning of nuclear androgen receptor.
18451138 A switch to type II PKA activity is not necessary for increased kinase activity or tumorigenesis.
18421013 The selective use of PKA and Epac-1 pathways to inhibit distinct aspects of fibroblast activation illustrate the pleiotropic ability of PGE(2) to inhibit diverse fibroblast functions.
18338250 Data provide the first evidence that 17beta-estradiol can inhibit PKA overactivation and PKA-induced tau hyperphosphorylation, implying a preventive role of 17beta-estradiol in AD-like tau pathology.
18215420 The results herein provide initial evidence that the inhibitory effect of hypoxia on MMP-9 by mature dendritic cells requires the activation of A(2b) in a cAMP/PKA-dependent pathway.
18178622 analysis of allosteric cooperativity in protein kinase A
18064650 These results suggest a novel mechanism of ANP protective effects against agonist-induced pulmonary endothelial cell barrier dysfunction via inhibition of Rho signaling by Epac/Rap1-Rac and PKA signaling cascades.
17975022 Data suggest that PKA effects on IFNT regulation might be mediated through CBP/p300 coactivation, particularly as CBP and Ets2 occupy the proximal promoter region of IFNT in bovine trophoblast CT-1 cells.
17959673 This study demonstrates that the phosphorylation of p50 and p65 by the catalytic subunit of protein kinase A (PKAc) is essential for NF-kappaB DNA binding and transactivation activity.
17909264 Vitamin K(2) modulates its target gene expression in osteoblastic cells through the PKA-dependent mechanism.
17908236 In patients with Alzheimer disease, over-activation of calpain because of calcium dysregulation causes increased degradation and thus decreased activity of PKA,which, in turn, contributes to down-regulation of CREB and impaired cognition and memory.
17895245 Protein kinase A, not Epac, suppresses hedgehog activity and regulates glucocorticoid sensitivity in acute lymphoblastic leukemia cells
17895239 Prostaglandin E2 activates HPK1 kinase activity via a PKA-dependent pathway
17884635 Contrary to the classical model of PKA activation, elevated cAMP does not allow RIalpha and Calpha to diffuse far apart unless the pseudosubstrate inhibitor PKI or locally concentrated substrate is coexpressed
17693412 PKA-dependent phosphorylation enhances the response of RyR2 to luminal Ca(2+) and reduces the threshold for SOICR and this effect of PKA is largely mediated by phosphorylation at Ser-2,030
17646929 PKA and VEGFR2 converge at the MEK/ERK1/2 pathway to protect serum starved neuronal cells from a caspase-dependent cell death.
17594903 Nuclear PKA C subunit co-locates with HA95 in splicing factor compartments and regulates pre-mRNA splicing, possibly through a cAMP-independent mechanism.
17581860 The anx 2-S100A10/CFTR complex is important for CFTR function across epithelia.
17565987 cyclic AMP-dependent protein kinase regulates proteasome function through phosphorylation of Rpt6
17553808 Protein phosphorylation by PRKACA at Ser(637) results in clear alterations in Drp1 function and mitochondrial morphology.
17545677 PTH induces an increased activity of the eNOS system through PKA and PKC pathways
17333334 STAT-3 activation by DFMO is at least in part mediated through the PKA pathway
17317104 These results indicate that the reactive oxygen species-mediated TNF-alpha-induced IL-8 transcription is regulated by NF-kappaB/RelA phosphorylation at the critical Ser(276) residue by PKAc, resulting in stable enhanceosome formation on target genes.
17296605 LXRalpha is regulated not only by oxysterol derivatives but also by PKA-mediated phosphorylation, which suggests that nutritional regulation of SREBP-1c and lipogenesis could be regulated at least partially through modulation of LXR
17151273 Opposite roles for the protein kinase A transgene are defined in the formation of initial memories and extinction memories, representing the first genetic evidence that protein kinases may be constraints for the extinction of fear.
17068197 Rap1 mediates cyclic AMP-stimulated neurotensin secretion downstream of both Epac and protein kinase A signaling pathways
17053039 activation of RankL gene expression by PKA- and gp130-inducers is mediated via common regulatory domains that also served to facilitate the activity of 1,25-(OH)2D3
17043752 Data show that activation-dependent expression of matrix metalloproteinases in peripheral blood mononuclear cells involves protein kinase A.
17008315 STAT3 activation by G alpha(s) distinctively requires protein kinase A, JNK, and phosphatidylinositol 3-kinase
16966355 Results suggest involvement of AMP-activated protein kinase in the control of expression of both metabolic genes, UCP3 and GLUT4, in the skeletal muscle of mice and of human newborns.
16920702 analysis of a novel mechanism for the phosphorylation of MYPT3 by PKA and activation of the catalytic activity through direct interaction of a central region of MYPT3 with its N-terminal region
16793902 Thus, PAR2 activates PKCepsilon and PKA in sensory neurons, and thereby sensitizes TRPV1 to cause thermal hyperalgesia.
16751804 transcriptomes associated with protein kinase A pathway was identified in human prostate cancer cells using Affymetrix GeneChip technology
16642035 Results suggest that gravin maintains a signaling complex that includes protein kinase A and phosphodiesterase 4D.
16621795 ATP binding specifically to the ATPC site in S2- InsP3R-1 controls the susceptibility of the receptor to protein kinase A-mediated phosphorylation
16601239 These observations suggest that in primary pulmonary fibroblasts, PKCalpha but not PKCdelta or PKCepsilon mediate the profibrotic effect of CCL18.
16476742 analysis of a novel, noncanonical mechanism of modulation of beta-catenin signaling through direct phosphorylation of beta-catenin by PKA, promoting its interaction with CREB-binding protein
16302972 Results imply a hindered transduction of the protein kinase A phosphorylation signal from cardiac troponin I to troponin C.
16301320 kinase inhibits the phosphatidylinositiol (3,4,5)-trisphosphate and Gbetagamma-mediated regulation of its activity
16179339 CTP synthetase is phosphorylated by protein kinase A
16166624 GCMa acetylation is mediated by CBP, which stimulates GCMa transcriptional activity through cyclic AMP/protein kinase A signaling
15975931 Protein kinase A-dependent phosphorylation of Lutheran/basal cell adhesion molecule glycoprotein regulates cell adhesion to laminin alpha5
15914039 A small but significant decrease in PKA, AKAP79, and PP2B in myometrial tissues from women in labor may contribute to a decrease in negative feedback on and enhancement of contractant signals at term
15905176 claudin-3 phosphorylation by PKA may provide a mechanism for the disruption of tight junctions in ovarian cancer
15843433 a pseudopodial-located RhoA/ROCK/p38/NHE1 signal module is regulated by Protein Kinase A gating and then regulates invasion in breast cancer cell lines
15703181 Protein kinase A regulates caspase-9 activation by Apaf-1 downstream of cytochrome c
15642694 repressor nuclear factor-kappaB p50/p50 binding to DNA depends on phosphorylation of Ser337 by the protein kinase A catalytic subunit
15629779 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells
15212956 PKACA is involved in extracellular (Ca2+) signalling mediated by the calcium sensing receptor.
15016832 Inhibition of PKCalpha markedly inhibited IP3-induced activation of calcium the current.
14981079 Merlin was phosphorylated by PKA in cells in which PAK activity was suppressed, indicating that the two kinases function independently. PKA can phosphorylate merlin at serine 518, promoting heterodimerization between merlin and ezrin
14500710 the effects of protein kinase A stimulation on sustained current in wild type and three disease-linked C-terminal mutant channels (D1790G, Y1795C, and Y1795H)
12972513 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells
12842892 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells
12574812 cAMP-induced inhibition of P-selectin expression is, in large part, mediated through activation of PKA.
12369791 Katacalcin regulates human CD14+ PBMC migration via signaling events involving protein kinase A-dependent cAMP pathways.
11997388 regulation of the membrane binding of PKCalpha
11903055 Protein kinase A enhances, whereas glycogen synthase kinase-3 beta inhibits, the activity of the exon 2-encoded transactivator domain of heterogeneous nuclear ribonucleoprotein D in a hierarchical fashion.
9730685 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells
9671211 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells
9540970 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells
9278385 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells
9151826 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells
7946090 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells
7688126 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells
1978848 BiFC assays demonstrate that HIV-1 Vpr directly interacts with PKA-C alpha in HeLa cells

AA Sequence

MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHY      1 - 70
AMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFS     71 - 140
EPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEI    141 - 210
ILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTK    211 - 280
RFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSE    281 - 350
F//

Text Mined References (459)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26978032 2016 Protein Kinase A Activation Promotes Cancer Cell Resistance to Glucose Starvation and Anoikis.
26701869 2016 Landscape of somatic mutations in sporadic GH-secreting pituitary adenomas.
26669444 2015 cAMP-induced phosphorylation of 26S proteasomes on Rpn6/PSMD11 enhances their activity and the degradation of misfolded proteins.
26505878 2016 The DNAJB1-PRKACA chimera: Candidate biomarker and therapeutic target for fibrolamellar carcinomas.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26435498 2015 Impaired degradation of WNK by Akt and PKA phosphorylation of KLHL3.
26387949 2015 PKA Phosphorylates the ATPase Inhibitory Factor 1 and Inactivates Its Capacity to Bind and Inhibit the Mitochondrial H(+)-ATP Synthase.
26358293 2015 PKA-mediated phosphorylation of Dexras1 suppresses iron trafficking by inhibiting S-nitrosylation.
26258546 2015 Protein kinase A activity is necessary for fission and fusion of Golgi to endoplasmic reticulum retrograde tubules.
26052940 2015 ULK2 Ser 1027 Phosphorylation by PKA Regulates Its Nuclear Localization Occurring through Karyopherin Beta 2 Recognition of a PY-NLS Motif.
25951193 2015 The integral membrane protein ITM2A, a transcriptional target of PKA-CREB, regulates autophagic flux via interaction with the vacuolar ATPase.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25913012 2015 Phosphorylation of ezrin on Thr567 is required for the synergistic activation of cell spreading by EPAC1 and protein kinase A in HEK293T cells.
25807930 2015 Multifunctional reagents for quantitative proteome-wide analysis of protein modification in human cells and dynamic profiling of protein lipidation during vertebrate development.
25775607 2015 Dysfunctional conformational dynamics of protein kinase A induced by a lethal mutant of phospholamban hinder phosphorylation.
25750087 2015 PRKACA mutations in cortisol-producing adenomas and adrenal hyperplasia: a single-center study of 60 cases.
25653177 2015 Hypothetical gene C18orf42 encodes a novel protein kinase A-binding protein.
25575591 2015 Anchoring of protein kinase A by ERM (ezrin-radixin-moesin) proteins is required for proper netrin signaling through DCC (deleted in colorectal cancer).
25557953 2015 Unique genomic profile of fibrolamellar hepatocellular carcinoma.
25477193 2014 PKA catalytic subunit mutations in adrenocortical Cushing's adenoma impair association with the regulatory subunit.
25449630 2015 Germline PRKACA amplification leads to Cushing syndrome caused by 3 adrenocortical pathologic phenotypes.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
25225481 2014 Sequence analysis of the catalytic subunit of PKA in somatotroph adenomas.
25213315 2015 PKA RI?/A-kinase anchoring proteins 10 signaling pathway and the prognosis of colorectal cancer.
25188285 2014 PKA compartmentalization via AKAP220 and AKAP12 contributes to endothelial barrier regulation.
25109834 2014 Prostaglandin E2 promotes the cell growth and invasive ability of hepatocellular carcinoma cells by upregulating c-Myc expression via EP4 receptor and the PKA signaling pathway.
25069672 2014 Somatic mutations of the catalytic subunit of cyclic AMP-dependent protein kinase (PRKACA) gene in Japanese patients with several adrenal adenomas secreting cortisol [Rapid Communication].
25057884 2014 Novel somatic mutations in the catalytic subunit of the protein kinase A as a cause of adrenal Cushing's syndrome: a European multicentric study.
25037568 2014 Long QT mutations at the interface between KCNQ1 helix C and KCNE1 disrupt I(KS) regulation by PKA and PIP?.
24909179 2015 PRKACA mediates resistance to HER2-targeted therapy in breast cancer cells and restores anti-apoptotic signaling.
24860872 2014 Analysis of 5-lipoxygenase phosphorylation on molecular level by MALDI-MS.
24855271 2014 Recurrent somatic mutations underlie corticotropin-independent Cushing's syndrome.
24813785 2014 Role of AKAP 149-PKA-PDE4A complex in cell survival and cell differentiation processes.
24747643 2014 Recurrent activating mutation in PRKACA in cortisol-producing adrenal tumors.
24733293 2014 Glucagon stimulates hepatic FGF21 secretion through a PKA- and EPAC-dependent posttranscriptional mechanism.
24700472 2014 Activating hotspot L205R mutation in PRKACA and adrenal Cushing's syndrome.
24627100 2014 Extracellular visfatin activates gluconeogenesis in HepG2 cells through the classical PKA/CREB-dependent pathway.
24605759 2014 Cyclic nucleotide mapping of hyperpolarization-activated cyclic nucleotide-gated (HCN) channels.
24578576 2014 Detection of a recurrent DNAJB1-PRKACA chimeric transcript in fibrolamellar hepatocellular carcinoma.
24571724 2014 Constitutive activation of PKA catalytic subunit in adrenal Cushing's syndrome.
24464040 2014 LRRK2 regulates synaptogenesis and dopamine receptor activation through modulation of PKA activity.
24389246 2014 Regulation of the biogenesis of OXPHOS complexes in cell transition from replicating to quiescent state: involvement of PKA and effect of hydroxytyrosol.
24351927 2014 Parkinson-related LRRK2 mutation R1441C/G/H impairs PKA phosphorylation of LRRK2 and disrupts its interaction with 14-3-3.
24344931 2013 HIV-1-associated PKA acts as a cofactor for genome reverse transcription.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24192058 2014 Enhancement of the p38 MAPK and PKA signaling pathways is associated with the pro-melanogenic activity of Interleukin 33 in primary melanocytes.
24140250 2014 Activation of cyclic AMP/PKA pathway inhibits bladder cancer cell invasion by targeting MAP4-dependent microtubule dynamics.
24037441 2014 Cyclic AMP-dependent protein kinase enhances SC35-promoted Tau exon 10 inclusion.
24028560 2014 Coxiella burnetii exploits host cAMP-dependent protein kinase signalling to promote macrophage survival.
23942052 2013 Human heart failure is accompanied by altered protein kinase A subunit expression and post-translational state.
23806656 2013 Protein kinase A and phosphodiesterase-4D3 binding to coding polymorphisms of cardiac muscle anchoring protein (mAKAP).
23797058 2013 cAMP inhibits migration, ruffling and paxillin accumulation in focal adhesions of pancreatic ductal adenocarcinoma cells: effects of PKA and EPAC.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23507255 2013 Dysfunctional ryanodine receptors in the heart: new insights into complex cardiovascular diseases.
23504319 2013 Protein kinase A regulates MYC protein through transcriptional and post-translational mechanisms in a catalytic subunit isoform-specific manner.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23410945 2014 Protein kinase A (PKA) pathway is functionally linked to androgen receptor (AR) in the progression of prostate cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23341462 2013 Forskolin-inducible cAMP pathway negatively regulates T-cell proliferation by uncoupling the interleukin-2 receptor complex.
23245330 2013 New insights into the molecular mechanisms underlying sensitivity/resistance to the atypical retinoid ST1926 in acute myeloid leukaemia cells: the role of histone H2A.Z, cAMP-dependent protein kinase A and the proteasome.
23220172 2013 Overexpression of human selenoprotein H in neuronal cells enhances mitochondrial biogenesis and function through activation of protein kinase A, protein kinase B, and cyclic adenosine monophosphate response element-binding protein pathway.
23074279 2012 Antagonism of VEGF-A-induced increase in vascular permeability by an integrin ?3?1-Shp-1-cAMP/PKA pathway.
22926037 2013 Different expression and function of the endocannabinoid system in human epicardial adipose tissue in relation to heart disease.
22908311 2012 PKA and PDE4D3 anchoring to AKAP9 provides distinct regulation of cAMP signals at the centrosome.
22797923 2012 ZNRF2 is released from membranes by growth factors and, together with ZNRF1, regulates the Na+/K+ATPase.
22750392 2012 Glucagon-like peptide-1 inhibits angiotensin II-induced mesangial cell damage via protein kinase A.
22728165 2012 Prostaglandin E2 stimulates S100A8 expression by activating protein kinase A and CCAAT/enhancer-binding-protein-beta in prostate cancer cells.
22669896 2012 Phytoestrogen genistein up-regulates endothelial nitric oxide synthase expression via activation of cAMP response element-binding protein in human aortic endothelial cells.
22609331 2012 Norepinephrine differentially modulates the innate inflammatory response provoked by amyloid-? peptide via action at ?-adrenoceptors and activation of cAMP/PKA pathway in human THP-1 macrophages.
22561749 2012 Acidosis-induced V-ATPase trafficking in salivary ducts is initiated by cAMP/PKA/CREB pathway via regulation of Rab11b expression.
22553202 2012 Role of deleted in breast cancer 1 (DBC1) protein in SIRT1 deacetylase activation induced by protein kinase A and AMP-activated protein kinase.
22504716 2012 Structure and function of the human sperm-specific isoform of protein kinase A (PKA) catalytic subunit C?2.
22479536 2012 Activation of protein kinase A and exchange protein directly activated by cAMP promotes adipocyte differentiation of human mesenchymal stem cells.
22452847 2012 Protein kinase A enhances lipopolysaccharide-induced IL-6, IL-8, and PGE? production by human gingival fibroblasts.
22433860 2012 Protein kinase A (PKA) phosphorylation of Na+/K+-ATPase opens intracellular C-terminal water pathway leading to third Na+-binding site in molecular dynamics simulations.
22384111 2012 Histamine derived from probiotic Lactobacillus reuteri suppresses TNF via modulation of PKA and ERK signaling.
22363678 2012 Anti-inflammatory role of the cAMP effectors Epac and PKA: implications in chronic obstructive pulmonary disease.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22272352 2012 RhoE is regulated by cyclic AMP and promotes fusion of human BeWo choriocarcinoma cells.
22132070 2011 Cyclic AMP-dependent protein kinase A regulates the alternative splicing of CaMKII?.
21957496 Differential effects of PKA-controlled CaMKK2 variants on neuronal differentiation.
21835884 2011 Increased PKA signaling disrupts recognition memory and spatial memory: role in Huntington's disease.
21812984 2011 The testis-specific C?2 subunit of PKA is kinetically indistinguishable from the common C?1 subunit of PKA.
21774789 2011 Mutants of protein kinase A that mimic the ATP-binding site of Aurora kinase.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21559296 2011 Identification of a novel TGF?/PKA signaling transduceome in mediating control of cell survival and metastasis in colon cancer.
21536683 2011 Protein kinase A activity at the endoplasmic reticulum surface is responsible for augmentation of human ether-a-go-go-related gene product (HERG).
21514275 2011 Protein kinase A activates and phosphorylates ROR?4 in vitro and takes part in ROR? activation by CaMK-IV.
21461565 Fibronectin increases RhoA activity through inhibition of PKA in the human gastric cancer cell line SGC-7901.
21423175 2011 Control of PKA stability and signalling by the RING ligase praja2.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21367856 2011 Cyclic AMP-dependent protein kinase regulates the alternative splicing of tau exon 10: a mechanism involved in tau pathology of Alzheimer disease.
21357689 2011 Protein kinase A is central for forward transport of two-pore domain potassium channels K2P3.1 and K2P9.1.
21269460 2011 Initial characterization of the human central proteome.
21209912 2010 Coordinated translocation of mammalian Gli proteins and suppressor of fused to the primary cilium.
21098703 2010 Homotypic gap junctional communication associated with metastasis suppression increases with PKA activity and is unaffected by PI3K inhibition.
21085490 2010 Protein kinase A binds and activates heat shock factor 1.
21075212 2011 A CRE that binds CREB and contributes to PKA-dependent regulation of the proximal promoter of human RAB25 gene.
20849292 2011 Cross-talk between protein kinase A and the MAPK-activated protein kinases RSK1 and MK5.
20732331 2010 Diversity of bisubstrate binding modes of adenosine analogue-oligoarginine conjugates in protein kinase a and implications for protein substrate interactions.
20716686 2010 PKA phosphorylates histone deacetylase 5 and prevents its nuclear export, leading to the inhibition of gene transcription and cardiomyocyte hypertrophy.
20664056 2010 Thrombospondin-1 induces platelet activation through CD36-dependent inhibition of the cAMP/protein kinase A signaling cascade.
20501673 2010 S1P1 and VEGFR-2 form a signaling complex with extracellularly regulated kinase 1/2 and protein kinase C-alpha regulating ML-1 thyroid carcinoma cell migration.
20484458 2010 Regulation of placental leptin expression by cyclic adenosine 5'-monophosphate involves cross talk between protein kinase A and mitogen-activated protein kinase signaling pathways.
20481595 2010 Design of selective, ATP-competitive inhibitors of Akt.
20356841 2010 Thrombin and collagen induce a feedback inhibitory signaling pathway in platelets involving dissociation of the catalytic subunit of protein kinase A from an NFkappaB-IkappaB complex.
20209159 2010 Reciprocally coupled residues crucial for protein kinase Pak2 activity calculated by statistical coupling analysis.
20159975 2010 Rapid modulation of the organic anion transporting polypeptide 2B1 (OATP2B1, SLCO2B1) function by protein kinase C-mediated internalization.
20137943 2010 Azole-based inhibitors of AKT/PKB for the treatment of cancer.
20045463 2010 KChIP4a regulates Kv4.2 channel trafficking through PKA phosphorylation.
19965870 2010 Global consequences of activation loop phosphorylation on protein kinase A.
19949837 2010 High glucose stimulates adipogenic and inhibits osteogenic differentiation in MG-63 cells through cAMP/protein kinase A/extracellular signal-regulated kinase pathway.
19923321 2010 Phosphorylation of serine 11 and serine 92 as new positive regulators of human Snail1 function: potential involvement of casein kinase-2 and the cAMP-activated kinase protein kinase A.
19920112 2009 Protein kinase A activation confers resistance to trastuzumab in human breast cancer cell lines.
19808666 2009 Regulation of protein kinase A activity by p90 ribosomal S6 kinase 1.
19789307 2009 Nuclear NF-kappaB p65 phosphorylation at serine 276 by protein kinase A contributes to the malignant phenotype of head and neck cancer.
19755416 2009 Docosahexaenoic acid enhances hepatic serum amyloid A expression via protein kinase A-dependent mechanism.
19711044 2009 PKA-mediated stabilization of FoxH1 negatively regulates ERalpha activity.
19692500 2009 CD9 regulates transcription factor GCM1 and ERVWE1 expression through the cAMP/protein kinase A signaling pathway.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19667072 2009 Modulation of Rho guanine exchange factor Lfc activity by protein kinase A-mediated phosphorylation.
19647741 2009 Phosphorylation of more than one site is required for tight interaction of human tau protein with 14-3-3zeta.
19618297 2009 Activation of TR4 orphan nuclear receptor gene promoter by cAMP/PKA and C/EBP signaling.
19573263 2009 Protein kinases A and C in post-mortem prefrontal cortex from persons with major depression and normal controls.
19483721 2009 Overexpressing PKIB in prostate cancer promotes its aggressiveness by linking between PKA and Akt pathways.
19403523 2009 Dynamically driven ligand selectivity in cyclic nucleotide binding domains.
19383776 2009 The paradoxical increase in cortisol secretion induced by dexamethasone in primary pigmented nodular adrenocortical disease involves a glucocorticoid receptor-mediated effect of dexamethasone on protein kinase A catalytic subunits.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19368997 2009 Inhibition of angiogenesis by extracellular protein kinase A.
19264843 2009 cAMP enhances estrogen-related receptor alpha (ERRalpha) transcriptional activity at the SP-A promoter by increasing its interaction with protein kinase A and steroid receptor coactivator 2 (SRC-2).
19210988 2009 Gravin dynamics regulates the subcellular distribution of PKA.
19197368 2009 Ser276 phosphorylation of NF-kB p65 by MSK1 controls SCF expression in inflammation.
19018281 2008 Ser649 and Ser650 are the major determinants of protein kinase A-mediated activation of human hormone-sensitive lipase against lipid substrates.
18953413 2008 HPV16 E7-dependent transformation activates NHE1 through a PKA-RhoA-induced inhibition of p38alpha.
18836454 2008 Phosphorylation of APOBEC3G by protein kinase A regulates its interaction with HIV-1 Vif.
18728186 2008 EPAC and PKA allow cAMP dual control over DNA-PK nuclear translocation.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18505929 2008 Growth factor regulation of estrogen receptor coregulator PELP1 functions via Protein Kinase A pathway.
18490653 2008 cAMP/PKA pathway activation in human mesenchymal stem cells in vitro results in robust bone formation in vivo.
18451148 2008 Androgens transduce the G alphas-mediated activation of protein kinase A in prostate cells.
18451138 2008 Protein kinase A effects of an expressed PRKAR1A mutation associated with aggressive tumors.
18421013 2008 Prostaglandin E2 inhibits specific lung fibroblast functions via selective actions of PKA and Epac-1.
18385332 2008 Protein kinase A-induced phosphorylation of the p65 subunit of nuclear factor-kappaB promotes Schwann cell differentiation into a myelinating phenotype.
18338250 2008 Estradiol attenuates tau hyperphosphorylation induced by upregulation of protein kinase-A.
18215420 2008 Hypoxia suppresses the production of MMP-9 by human monocyte-derived dendritic cells and requires activation of adenosine receptor A2b via cAMP/PKA signaling pathway.
18178622 2008 Allosteric cooperativity in protein kinase A.
18064650 2008 Epac/Rap and PKA are novel mechanisms of ANP-induced Rac-mediated pulmonary endothelial barrier protection.
17975022 2008 Combinatorial roles of protein kinase A, Ets2, and 3',5'-cyclic-adenosine monophosphate response element-binding protein-binding protein/p300 in the transcriptional control of interferon-tau expression in a trophoblast cell line.
17959673 2008 Tumorigenic adenovirus type 12 E1A inhibits phosphorylation of NF-kappaB by PKAc, causing loss of DNA binding and transactivation.
17911601 2007 Inhibition of T cell activation by cyclic adenosine 5'-monophosphate requires lipid raft targeting of protein kinase A type I by the A-kinase anchoring protein ezrin.
17909264 2007 Vitamin K2 induces phosphorylation of protein kinase A and expression of novel target genes in osteoblastic cells.
17908236 2007 Down-regulation of cAMP-dependent protein kinase by over-activated calpain in Alzheimer disease brain.
17895245 2007 Protein kinase A, not Epac, suppresses hedgehog activity and regulates glucocorticoid sensitivity in acute lymphoblastic leukemia cells.
17895239 2007 Prostaglandin E2 activates HPK1 kinase activity via a PKA-dependent pathway.
17884635 2007 Isoform-specific PKA dynamics revealed by dye-triggered aggregation and DAKAP1alpha-mediated localization in living cells.
17693412 2007 Functional consequence of protein kinase A-dependent phosphorylation of the cardiac ryanodine receptor: sensitization of store overload-induced Ca2+ release.
17646929 2007 The VEGFR2 and PKA pathways converge at MEK/ERK1/2 to promote survival in serum deprived neuronal cells.
17594903 2007 Involvement of the catalytic subunit of protein kinase A and of HA95 in pre-mRNA splicing.
17581860 2007 The formation of the cAMP/protein kinase A-dependent annexin 2-S100A10 complex with cystic fibrosis conductance regulator protein (CFTR) regulates CFTR channel function.
17565987 2007 Proteasome function is regulated by cyclic AMP-dependent protein kinase through phosphorylation of Rpt6.
17553808 2007 Cyclic AMP-dependent protein kinase phosphorylation of Drp1 regulates its GTPase activity and mitochondrial morphology.
17545677 2007 Parathyroid hormone stimulates the endothelial nitric oxide synthase through protein kinase A and C pathways.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17333334 2008 Activation of protein kinase A (PKA) signaling mitigates the antiproliferative and antiinvasive effects of alpha-difluoromethylornithine in breast cancer cells.
17317104 2007 TNF-alpha-induced NF-kappaB/RelA Ser(276) phosphorylation and enhanceosome formation is mediated by an ROS-dependent PKAc pathway.
17296605 2007 Protein kinase A suppresses sterol regulatory element-binding protein-1C expression via phosphorylation of liver X receptor in the liver.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
17151273 2006 Transgenic inhibition of neuronal protein kinase A activity facilitates fear extinction.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17068197 2007 Cyclic adenosine 5'-monophosphate-stimulated neurotensin secretion is mediated through Rap1 downstream of both Epac and protein kinase A signaling pathways.
17053039 2007 Transcriptional control of receptor activator of nuclear factor-kappaB ligand by the protein kinase A activator forskolin and the transmembrane glycoprotein 130-activating cytokine, oncostatin M, is exerted through multiple distal enhancers.
17043752 2007 Activation dependent expression of MMPs in peripheral blood mononuclear cells involves protein kinase A.
17008315 2006 Activation of STAT3 by G alpha(s) distinctively requires protein kinase A, JNK, and phosphatidylinositol 3-kinase.
16966355 2006 Expression of uncoupling protein 3 and GLUT4 gene in skeletal muscle of preterm newborns: possible control by AMP-activated protein kinase.
16920702 2006 Phosphorylation of myosin phosphatase targeting subunit 3 (MYPT3) and regulation of protein phosphatase 1 by protein kinase A.
16793902 2006 Protease-activated receptor 2 sensitizes TRPV1 by protein kinase Cepsilon- and A-dependent mechanisms in rats and mice.
16765046 2006 Discovery of 2-pyrimidyl-5-amidothiophenes as potent inhibitors for AKT: synthesis and SAR studies.
16751804 2006 Identification of genes targeted by the androgen and PKA signaling pathways in prostate cancer cells.
16642035 2006 An anchored PKA and PDE4 complex regulates subplasmalemmal cAMP dynamics.
16621795 2006 ATP binding to a unique site in the type-1 S2- inositol 1,4,5-trisphosphate receptor defines susceptibility to phosphorylation by protein kinase A.
16601239 2006 PKCalpha mediates CCL18-stimulated collagen production in pulmonary fibroblasts.
16476742 2006 Phosphorylation of beta-catenin by cyclic AMP-dependent protein kinase.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16407073 2006 Dynamic binding of PKA regulatory subunit RI alpha.
16387847 2006 PKA-mediated phosphorylation regulates the function of activation-induced deaminase (AID) in B cells.
16302972 2005 Cardiac troponin C-L29Q, related to hypertrophic cardiomyopathy, hinders the transduction of the protein kinase A dependent phosphorylation signal from cardiac troponin I to C.
16301320 2006 Phosphorylation of P-Rex1 by the cyclic AMP-dependent protein kinase inhibits the phosphatidylinositiol (3,4,5)-trisphosphate and Gbetagamma-mediated regulation of its activity.
16179339 2005 Expression of Human CTP synthetase in Saccharomyces cerevisiae reveals phosphorylation by protein kinase A.
16166624 2005 Stimulation of GCMa transcriptional activity by cyclic AMP/protein kinase A signaling is attributed to CBP-mediated acetylation of GCMa.
15975931 2005 Protein kinase A-dependent phosphorylation of Lutheran/basal cell adhesion molecule glycoprotein regulates cell adhesion to laminin alpha5.
15914039 2005 Differential expression of protein kinase A, AKAP79, and PP2B in pregnant human myometrial membranes prior to and during labor.
15905176 2005 Phosphorylation of claudin-3 at threonine 192 by cAMP-dependent protein kinase regulates tight junction barrier function in ovarian cancer cells.
15843433 2005 Protein kinase A gating of a pseudopodial-located RhoA/ROCK/p38/NHE1 signal module regulates invasion in breast cancer cell lines.
15703181 2005 Protein kinase A regulates caspase-9 activation by Apaf-1 downstream of cytochrome c.
15655353 2005 The second subunit of the replication factor C complex (RFC40) and the regulatory subunit (RIalpha) of protein kinase A form a protein complex promoting cell survival.
15642694 2005 DNA binding of repressor nuclear factor-kappaB p50/p50 depends on phosphorylation of Ser337 by the protein kinase A catalytic subunit.
15632203 2005 Rap1GAP2 is a new GTPase-activating protein of Rap1 expressed in human platelets.
15630084 2005 A-kinase-interacting protein localizes protein kinase A in the nucleus.
15569306 2004 D1 dopamine receptor signaling involves caveolin-2 in HEK-293 cells.
15546918 2004 PKA phosphorylation of Src mediates Rap1 activation in NGF and cAMP signaling in PC12 cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15371306 2004 Potential role of protein tyrosine phosphatase nonreceptor type 13 in the control of oocyte meiotic maturation.
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15212956 2004 Involvement of protein kinase C-alpha and -epsilon in extracellular Ca(2+) signalling mediated by the calcium sensing receptor.
15096524 2004 Rab13 regulates PKA signaling during tight junction assembly.
15024086 2004 A novel mTOR-regulated phosphorylation site in elongation factor 2 kinase modulates the activity of the kinase and its binding to calmodulin.
15016832 2004 Protein kinase Calpha phosphorylates the TRPC1 channel and regulates store-operated Ca2+ entry in endothelial cells.
14997482 2004 Identification and characterization of phosphorylated proteins in the human pituitary.
14981079 2004 Cyclic AMP-dependent protein kinase phosphorylates merlin at serine 518 independently of p21-activated kinase and promotes merlin-ezrin heterodimerization.
14724137 2004 Rosbin: a novel homeobox-like protein gene expressed exclusively in round spermatids.
14709557 2004 Stimulation of the AMP-activated protein kinase leads to activation of eukaryotic elongation factor 2 kinase and to its phosphorylation at a novel site, serine 398.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14701748 2004 Negative regulation of histone deacetylase 8 activity by cyclic AMP-dependent protein kinase A.
14641008 2003 Molecular mechanisms regulating hormone-sensitive lipase and lipolysis.
14636580 2003 PKA, PKC, and the protein phosphatase 2A influence HAND factor function: a mechanism for tissue-specific transcriptional regulation.
14597563 2004 Ischemia-induced phosphorylation of phospholemman directly activates rat cardiac Na/K-ATPase.
14576165 2004 Phosphorylation of presenilin 1 at the caspase recognition site regulates its proteolytic processing and the progression of apoptosis.
14532276 2003 Characterization of recombinant skeletal muscle (Ser-2843) and cardiac muscle (Ser-2809) ryanodine receptor phosphorylation mutants.
14500710 2003 Modulation of cardiac sodium channel gating by protein kinase A can be altered by disease-linked mutation.
12954600 2003 Ca2+-dependent inhibition of NHE3 requires PKC alpha which binds to E3KARP to decrease surface NHE3 containing plasma membrane complexes.
12950172 2003 In vitro modulation of the interaction between HA95 and LAP2beta by cAMP signaling.
12947093 2003 Phosphorylation of serine 337 of NF-kappaB p50 is critical for DNA binding.
12938160 2003 Identification of an IQGAP1/AKAP79 complex in beta-cells.
12931191 2003 BAD and glucokinase reside in a mitochondrial complex that integrates glycolysis and apoptosis.
12927815 2003 Molecular characterization of human ninein protein: two distinct subdomains required for centrosomal targeting and regulating signals in cell cycle.
12917345 2003 Acetylation-mediated transcriptional activation of the ETS protein ER81 by p300, P/CAF, and HER2/Neu.
12853467 2003 14-3-3s regulate fructose-2,6-bisphosphate levels by binding to PKB-phosphorylated cardiac fructose-2,6-bisphosphate kinase/phosphatase.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12851456 2003 Protein kinase A phosphorylation modulates transport of the polypyrimidine tract-binding protein.
12842892 2003 Active cAMP-dependent protein kinase incorporated within highly purified HIV-1 particles is required for viral infectivity and interacts with viral capsid protein.
12819195 2003 Regulation of A + U-rich element-directed mRNA turnover involving reversible phosphorylation of AUF1.
12773393 2003 MSK2 and MSK1 mediate the mitogen- and stress-induced phosphorylation of histone H3 and HMG-14.
12721358 2003 A humble hexose monophosphate pathway metabolite regulates short- and long-term control of lipogenesis.
12697024 2003 Okadaic acid-induced, naringin-sensitive phosphorylation of glycine N-methyltransferase in isolated rat hepatocytes.
12654918 2003 Serine phosphorylation negatively regulates RhoA in vivo.
12639913 2003 Regulation of melanocortin-4 receptor signaling: agonist-mediated desensitization and internalization.
12630910 2003 Post-synaptic density-95 promotes calcium/calmodulin-dependent protein kinase II-mediated Ser847 phosphorylation of neuronal nitric oxide synthase.
12628924 2003 Transcriptional activation of the NF-kappaB p65 subunit by mitogen- and stress-activated protein kinase-1 (MSK1).
12626323 2003 Glucagon and regulation of glucose metabolism.
12578970 2003 cAMP-dependent protein kinase phosphorylation of the acid-sensing ion channel-1 regulates its binding to the protein interacting with C-kinase-1.
12574812 2003 Differential regulation of P-selectin expression by protein kinase A and protein kinase G in thrombin-stimulated human platelets.
12569367 2003 Regulation of the ER81 transcription factor and its coactivators by mitogen- and stress-activated protein kinase 1 (MSK1).
12538592 2003 Phosphorylation of the Ras-GRF1 exchange factor at Ser916/898 reveals activation of Ras signaling in the cerebral cortex.
12534294 2003 Phosphorylation of RGS14 by protein kinase A potentiates its activity toward G alpha i.
12529267 2003 Selective phosphorylation of the IP3R-I in vivo by cGMP-dependent protein kinase in smooth muscle.
12509440 2003 Phosphoproteome analysis of capacitated human sperm. Evidence of tyrosine phosphorylation of a kinase-anchoring protein 3 and valosin-containing protein/p97 during capacitation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475942 2002 Characterization of an A-kinase anchoring protein in human ciliary axonemes.
12469130 2003 A developmental switch in the signaling cascades for LTP induction.
12459461 2002 Differential phosphorylation of SNAP-25 in vivo by protein kinase C and protein kinase A.
12441002 2003 Molecular cloning and subcellular distribution of the novel PDE4B4 cAMP-specific phosphodiesterase isoform.
12435421 2002 Aberrant glycosylation modulates phosphorylation of tau by protein kinase A and dephosphorylation of tau by protein phosphatase 2A and 5.
12417592 2003 Phosphorylation of spinophilin modulates its interaction with actin filaments.
12399457 2003 Protein kinase A-mediated phosphorylation of the Galpha13 switch I region alters the Galphabetagamma13-G protein-coupled receptor complex and inhibits Rho activation.
12392720 2002 Phosphorylation of the stress-activated protein kinase, MEKK3, at serine 166.
12387894 2002 Involvement of aberrant glycosylation in phosphorylation of tau by cdk5 and GSK-3beta.
12372837 2002 Phosphorylation of the catalytic subunit of protein kinase A. Autophosphorylation versus phosphorylation by phosphoinositide-dependent kinase-1.
12369791 2002 Involvement of cyclic adenosine monophosphate-dependent protein kinase A and pertussis toxin-sensitive G proteins in the migratory response of human CD14+ mononuclear cells to katacalcin.
12237306 2002 Synapsin I is phosphorylated at Ser603 by p21-activated kinases (PAKs) in vitro and in PC12 cells stimulated with bradykinin.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
12213813 2002 Regulation of the ETS transcription factor ER81 by the 90-kDa ribosomal S6 kinase 1 and protein kinase A.
12196520 2002 Protein kinase A site-specific phosphorylation regulates ATP-binding cassette A1 (ABCA1)-mediated phospholipid efflux.
12175859 Phosphorylation of the recombinant rho1 GABA receptor.
12167624 2002 Nopp140 is a mediator of the protein kinase A signaling pathway that activates the acute phase response alpha1-acid glycoprotein gene.
12154078 2002 Regulation of the CDK-related protein kinase PCTAIRE-1 and its possible role in neurite outgrowth in Neuro-2A cells.
12147701 2002 A-kinase anchoring protein AKAP220 binds to glycogen synthase kinase-3beta (GSK-3beta ) and mediates protein kinase A-dependent inhibition of GSK-3beta.
12089143 2002 cAMP inhibition of Akt is mediated by activated and phosphorylated Rap1b.
12054501 2002 Human serum and glucocorticoid-inducible kinase-like kinase (SGKL) phosphorylates glycogen syntheses kinase 3 beta (GSK-3beta) at serine-9 through direct interaction.
11997508 2002 Cyclic AMP blocks cell growth through Raf-1-dependent and Raf-1-independent mechanisms.
11997388 2002 Interplay between calcium, diacylglycerol, and phosphorylation in the spatial and temporal regulation of PKCalpha-GFP.
11986331 2002 Autophosphorylation of the mammalian multifunctional protein that initiates de novo pyrimidine biosynthesis.
11971957 2002 Cyclic AMP-dependent kinase regulates Raf-1 kinase mainly by phosphorylation of serine 259.
11953308 2002 14-3-3 amplifies and prolongs adrenergic stimulation of HERG K+ channel activity.
11903055 2002 Protein kinase A enhances, whereas glycogen synthase kinase-3 beta inhibits, the activity of the exon 2-encoded transactivator domain of heterogeneous nuclear ribonucleoprotein D in a hierarchical fashion.
11895474 2002 Phosphorylation and reorganization of vimentin by p21-activated kinase (PAK).
11884598 2002 Convergence of multiple signaling cascades at glycogen synthase kinase 3: Edg receptor-mediated phosphorylation and inactivation by lysophosphatidic acid through a protein kinase C-dependent intracellular pathway.
11853558 2002 Identification and characterization of four novel phosphorylation sites (Ser31, Ser325, Thr336 and Thr366) on LKB1/STK11, the protein kinase mutated in Peutz-Jeghers cancer syndrome.
11834733 2002 Formation of inactive cAMP-saturated holoenzyme of cAMP-dependent protein kinase under physiological conditions.
11805122 2002 Phosphorylation of stargazin by protein kinase A regulates its interaction with PSD-95.
11799117 2002 A structural model of the catalytic subunit-regulatory subunit dimeric complex of the cAMP-dependent protein kinase.
11751901 2002 Modulation of hormone-sensitive lipase and protein kinase A-mediated lipolysis by perilipin A in an adenoviral reconstituted system.
11749387 2001 Glycogen synthase kinase-3: properties, functions, and regulation.
11744745 2001 Phosphorylation of Ser(982) in the sodium bicarbonate cotransporter kNBC1 shifts the HCO(3)(-) : Na(+) stoichiometry from 3 : 1 to 2 : 1 in murine proximal tubule cells.
11696326 2001 Interaction of heterotrimeric G13 protein with an A-kinase-anchoring protein 110 (AKAP110) mediates cAMP-independent PKA activation.
11694504 2002 Phosphorylation of inositol 1,4,5-trisphosphate receptors in parotid acinar cells. A mechanism for the synergistic effects of cAMP on Ca2+ signaling.
11604405 2001 Phosphorylation of cysteine string protein by protein kinase A. Implications for the modulation of exocytosis.
11551945 2001 Cell type-specific inhibition of the ETS transcription factor ER81 by mitogen-activated protein kinase-activated protein kinase 2.
11533025 2001 Phosphorylation of the integrin alpha 4 cytoplasmic domain regulates paxillin binding.
11510412 2001 Phosphorylation by PKA of a site unique to B-Raf kinase.
11500364 2001 Regulation of elongation factor 2 kinase by p90(RSK1) and p70 S6 kinase.
11443111 2001 Phosphorylation and nuclear translocation of a regulator of G protein signaling (RGS10).
11438671 2001 Mitotic phosphorylation prevents the binding of HMGN proteins to chromatin.
11416140 2001 Downregulation of CIITA function by protein kinase a (PKA)-mediated phosphorylation: mechanism of prostaglandin E, cyclic AMP, and PKA inhibition of class II major histocompatibility complex expression in monocytic lines.
11359875 2001 Interaction of phosphorylated tyrosine hydroxylase with 14-3-3 proteins: evidence for a phosphoserine 40-dependent association.
11336675 2001 Crystal structure of the 14-3-3zeta:serotonin N-acetyltransferase complex. a role for scaffolding in enzyme regulation.
11331285 2001 Modulation of the G protein regulator phosducin by Ca2+/calmodulin-dependent protein kinase II phosphorylation and 14-3-3 protein binding.
11311121 2001 The kinase DYRK phosphorylates protein-synthesis initiation factor eIF2Bepsilon at Ser539 and the microtubule-associated protein tau at Thr212: potential role for DYRK as a glycogen synthase kinase 3-priming kinase.
11297520 2001 Phosphorylation of the protein kinase mutated in Peutz-Jeghers cancer syndrome, LKB1/STK11, at Ser431 by p90(RSK) and cAMP-dependent protein kinase, but not its farnesylation at Cys(433), is essential for LKB1 to suppress cell vrowth.
11283605 2001 Phosphorylation of Snapin by PKA modulates its interaction with the SNARE complex.
11279195 2001 Phosphorylation of centrin during the cell cycle and its role in centriole separation preceding centrosome duplication.
11278469 2001 Regulation of membrane targeting of the G protein-coupled receptor kinase 2 by protein kinase A and its anchoring protein AKAP79.
11181841 2001 Characterization of the in vitro phosphorylation of human tau by tau protein kinase II (cdk5/p20) using mass spectrometry.
11181701 2001 Activation of the COOH-terminal Src kinase (Csk) by cAMP-dependent protein kinase inhibits signaling through the T cell receptor.
11181181 2001 Inward rectifier potassium channel Kir2.2 is associated with synapse-associated protein SAP97.
11171059 2001 Phosphorylation of elongation factor-2 kinase on serine 499 by cAMP-dependent protein kinase induces Ca2+/calmodulin-independent activity.
11158305 2001 Identification of a major cyclic AMP-dependent protein kinase A phosphorylation site within the cytoplasmic tail of the low-density lipoprotein receptor-related protein: implication for receptor-mediated endocytosis.
11158204 2001 Regulation of Bcl2 phosphorylation and potential significance for leukemic cell chemoresistance.
11104762 2001 Phosphorylation of tau is regulated by PKN.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
11050185 2000 Phosphorylation near nuclear localization signal regulates nuclear import of adenomatous polyposis coli protein.
11039908 2000 The mitotic serine/threonine kinase Aurora2/AIK is regulated by phosphorylation and degradation.
11035810 2000 Phosphorylation and inactivation of glycogen synthase kinase 3 by protein kinase A.
11029056 2000 Phosphorylation-dependent localization of microtubule-associated protein MAP2c to the actin cytoskeleton.
11027313 2000 Cytoplasmic catalytic subunit of protein kinase A mediates cross-repression by NF-kappa B and the glucocorticoid receptor.
10982398 2000 The unique catalytic subunit of sperm cAMP-dependent protein kinase is the product of an alternative Calpha mRNA expressed specifically in spermatogenic cells.
10969067 2000 The neuropeptide processing enzyme EC 3.4.24.15 is modulated by protein kinase A phosphorylation.
10949026 2000 14-3-3 proteins and survival kinases cooperate to inactivate BAD by BH3 domain phosphorylation.
10922374 2000 KT5823 inhibits cGMP-dependent protein kinase activity in vitro but not in intact human platelets and rat mesangial cells.
10906071 2000 A novel isoform of human cyclic 3',5'-adenosine monophosphate-dependent protein kinase, c alpha-s, localizes to sperm midpiece.
10898738 2000 VACM-1, a cullin gene family member, regulates cellular signaling.
10880354 2000 Regulation of BAD by cAMP-dependent protein kinase is mediated via phosphorylation of a novel site, Ser155.
10874031 2000 Inhibition of neuronal nitric-oxide synthase by calcium/ calmodulin-dependent protein kinase IIalpha through Ser847 phosphorylation in NG108-15 neuronal cells.
10851246 2000 Regulation of human endothelial cell focal adhesion sites and migration by cGMP-dependent protein kinase I.
10841548 2000 Expression of a nonmyristylated variant of the catalytic subunit of protein kinase A during male germ-cell development.
10837486 2000 BAD Ser-155 phosphorylation regulates BAD/Bcl-XL interaction and cell survival.
10837251 2000 Cyclic AMP regulates the HERG K(+) channel by dual pathways.
10830164 2000 PKA phosphorylation dissociates FKBP12.6 from the calcium release channel (ryanodine receptor): defective regulation in failing hearts.
10805756 2000 Phosphorylation of SOX9 by cyclic AMP-dependent protein kinase A enhances SOX9's ability to transactivate a Col2a1 chondrocyte-specific enhancer.
10753751 2000 Pericentrin anchors protein kinase A at the centrosome through a newly identified RII-binding domain.
10739259 2000 Phosphorylation and subcellular redistribution of high mobility group proteins 14 and 17, analyzed by mass spectrometry.
10737616 2000 Phosphorylation sites on tau identified by nanoelectrospray mass spectrometry: differences in vitro between the mitogen-activated protein kinases ERK2, c-Jun N-terminal kinase and P38, and glycogen synthase kinase-3beta.
10728420 2000 Human connexin40 gap junction channels are modulated by cAMP.
10698939 2000 Identification of a pocket in the PDK1 kinase domain that interacts with PIF and the C-terminal residues of PKA.
10667577 2000 Protein phosphorylation is a regulatory mechanism for O6-alkylguanine-DNA alkyltransferase in human brain tumor cells.
10653665 2000 Phosphorylation of recombinant human ATP:citrate lyase by cAMP-dependent protein kinase abolishes homotropic allosteric regulation of the enzyme by citrate and increases the enzyme activity. Allosteric activation of ATP:citrate lyase by phosphorylated sugars.
10604473 1999 Phosphorylation of DARPP-32 by Cdk5 modulates dopamine signalling in neurons.
10601328 1999 A novel regulatory mechanism of MAP kinases activation and nuclear translocation mediated by PKA and the PTP-SL tyrosine phosphatase.
10576742 1999 Phosphorylation and regulation of Raf by Akt (protein kinase B).
10571231 1999 A phospho-switch controls the dynamic association of synapsins with synaptic vesicles.
10559944 1999 Crosstalk between cAMP-dependent kinase and MAP kinase through a protein tyrosine phosphatase.
10454575 1999 Insulin-induced phosphorylation and activation of cyclic nucleotide phosphodiesterase 3B by the serine-threonine kinase Akt.
10446213 1999 Immune complex-induced integrin activation and L-plastin phosphorylation require protein kinase A.
10400690 1999 Regulation of neuronal nitric-oxide synthase by calmodulin kinases.
10366608 1999 Characterization of phosphorylation sites on the glutamate receptor 4 subunit of the AMPA receptors.
10228048 1999 Diminished levels of protein kinase A RI alpha and RI beta transcripts and proteins in systemic lupus erythematosus T lymphocytes.
10090741 1999 Phosphorylation that detaches tau protein from microtubules (Ser262, Ser214) also protects it against aggregation into Alzheimer paired helical filaments.
10051666 1999 Molecular identification of human G-substrate, a possible downstream component of the cGMP-dependent protein kinase cascade in cerebellar Purkinje cells.
9891036 1999 Phosphorylation of human estrogen receptor alpha by protein kinase A regulates dimerization.
9867809 1999 Effect of phosphorylation on activities of Rap1A to interact with Raf-1 and to suppress Ras-dependent Raf-1 activation.
9832145 1998 New phosphorylation sites identified in hyperphosphorylated tau (paired helical filament-tau) from Alzheimer's disease brain using nanoelectrospray mass spectrometry.
9771888 1998 Tau is phosphorylated by GSK-3 at several sites found in Alzheimer disease and its biological activity markedly inhibited only after it is prephosphorylated by A-kinase.
9735171 1998 Phosphorylation of tau at both Thr 231 and Ser 262 is required for maximal inhibition of its binding to microtubules.
9730685 HIV-1 tat molecular diversity and induction of TNF-alpha: implications for HIV-induced neurological disease.
9724719 1998 Protein kinase A-catalyzed phosphorylation of heat shock protein 60 chaperone regulates its attachment to histone 2B in the T lymphocyte plasma membrane.
9722526 1998 Regulation of erythroid Krüppel-like factor (EKLF) transcriptional activity by phosphorylation of a protein kinase casein kinase II site within its interaction domain.
9710607 1998 14-3-3 proteins are required for maintenance of Raf-1 phosphorylation and kinase activity.
9679146 1998 Adducin is an in vivo substrate for protein kinase C: phosphorylation in the MARCKS-related domain inhibits activity in promoting spectrin-actin complexes and occurs in many cells, including dendritic spines of neurons.
9677319 1998 Effects of phosphorylation on function of the Rad GTPase.
9671211 1998 Human immunodeficiency virus Tat protein induces interleukin 6 mRNA expression in human brain endothelial cells via protein kinase C- and cAMP-dependent protein kinase pathways.
9660950 1998 Phosphorylation of NF-kappa B p65 by PKA stimulates transcriptional activity by promoting a novel bivalent interaction with the coactivator CBP/p300.
9565682 1998 Characterization of tau phosphorylation in glycogen synthase kinase-3beta and cyclin dependent kinase-5 activator (p23) transfected cells.
9546672 1998 Sequential phosphorylation of Tau by glycogen synthase kinase-3beta and protein kinase A at Thr212 and Ser214 generates the Alzheimer-specific epitope of antibody AT100 and requires a paired-helical-filament-like conformation.
9525956 1998 Identification of in vitro phosphorylation sites in the growth cone protein SCG10. Effect Of phosphorylation site mutants on microtubule-destabilizing activity.
9468536 1998 Transgenic approaches to define the functional role of dual site phospholamban phosphorylation.
9417067 1998 Identification of novel phosphorylation sites in hormone-sensitive lipase that are phosphorylated in response to isoproterenol and govern activation properties in vitro.
9407077 1997 Properties and phosphorylation sites of baculovirus-expressed nuclear inhibitor of protein phosphatase-1 (NIPP-1).
9405392 1997 Dissecting the cooperative reassociation of the regulatory and catalytic subunits of cAMP-dependent protein kinase. Role of Trp-196 in the catalytic subunit.
9374536 1997 Expression, purification, and regulation of two isoforms of the inositol 1,4,5-trisphosphate 3-kinase.
9366517 1997 Inhibition of the DNA-binding and transcriptional repression activity of the Wilms' tumor gene product, WT1, by cAMP-dependent protein kinase-mediated phosphorylation of Ser-365 and Ser-393 in the zinc finger domain.
9353289 1997 Phosphorylation by neuronal cdc2-like protein kinase promotes dimerization of Tau protein in vitro.
9341190 1997 The homeodomain protein Arix interacts synergistically with cyclic AMP to regulate expression of neurotransmitter biosynthetic genes.
9278385 1997 The Tat protein of HIV-1 induces tumor necrosis factor-alpha production. Implications for HIV-1-associated neurological diseases.
9247274 1997 cAMP-dependent regulation of cardiac L-type Ca2+ channels requires membrane targeting of PKA and phosphorylation of channel subunits.
9199504 1997 Phosphorylation of microtubule-associated protein tau by stress-activated protein kinases.
9155020 1997 D-myo-inositol 1,4,5-trisphosphate 3-kinase A is activated by receptor activation through a calcium:calmodulin-dependent protein kinase II phosphorylation mechanism.
9151826 1997 The Nef protein of human immunodeficiency virus type 1 enhances serine phosphorylation of the viral matrix.
9150141 1997 The transcriptional activity of NF-kappaB is regulated by the IkappaB-associated PKAc subunit through a cyclic AMP-independent mechanism.
9126608 1997 Purification, characterization, and in vitro phosphorylation of the neuron-specific membrane-associated protein SCG10.
9115213 1997 Bcl-2 phosphorylation required for anti-apoptosis function.
9109552 1997 Phosphorylation and activation of brain tryptophan hydroxylase: identification of serine-58 as a substrate site for protein kinase A.
9099667 1997 Phosphorylation of glial fibrillary acidic protein at the same sites by cleavage furrow kinase and Rho-associated kinase.
9091312 1997 Identification of Raf-1 Ser621 kinase activity from NIH 3T3 cells as AMP-activated protein kinase.
9050991 1997 The RIalpha subunit of protein kinase A (PKA) binds to Grb2 and allows PKA interaction with the activated EGF-receptor.
9030586 1997 Protein kinase A (PKA)- and protein kinase C-phosphorylated glia maturation factor promotes the catalytic activity of PKA.
9029147 1997 A protein-arginine methyltransferase binds to the intracytoplasmic domain of the IFNAR1 chain in the type I interferon receptor.
8999860 1997 The regulatory Ser262 of microtubule-associated protein tau is phosphorylated by phosphorylase kinase.
8939981 1996 The cleavage of protein kinase A by the kinase-splitting membranal proteinase is reproduced by meprin beta.
8884279 1996 The gene encoding the catalytic subunit C alpha of cAMP-dependent protein kinase (locus PRKACA) localizes to human chromosome region 19p13.1.
8816779 1996 Ethanol causes translocation of cAMP-dependent protein kinase catalytic subunit to the nucleus.
8810272 1996 Adducin regulation. Definition of the calmodulin-binding domain and sites of phosphorylation by protein kinases A and C.
8664319 1996 Cyclic AMP-dependent protein kinase phosphorylates residues in the C-terminal domain of the cardiac L-type calcium channel alpha1 subunit.
8663994 1996 Characterization of multiple phosphorylation sites on the AMPA receptor GluR1 subunit.
8663227 1996 Phosphorylation and activation of a cAMP-specific phosphodiesterase by the cAMP-dependent protein kinase. Involvement of serine 54 in the enzyme activation.
8626720 1996 Identification of the site in the cGMP-inhibited phosphodiesterase phosphorylated in adipocytes in response to insulin and isoproterenol.
8626492 1996 Protein kinase A-dependent phosphorylation of GLUT2 in pancreatic beta cells.
8612821 1996 A potential site of functional modulation by protein kinase A in the cardiac Ca2+ channel alpha 1C subunit.
8521865 1995 Phosphorylation of the N-terminal intracellular tail of sucrase-isomaltase by cAMP-dependent protein kinase.
8506364 1993 Phosphorylation of Ser-42 and Ser-59 in the N-terminal region of the tyrosine kinase p56lck.
8404858 1993 Multiple and cooperative phosphorylation events regulate the CREM activator function.
8395513 1993 Identification of phosphorylation sites in the recombinant catalytic subunit of cAMP-dependent protein kinase.
8390988 1993 Phosphorylation of connexin-32 by protein kinase C prevents its proteolysis by mu-calpain and m-calpain.
8380342 1993 Phosphorylation of serine 2843 in ryanodine receptor-calcium release channel of skeletal muscle by cAMP-, cGMP- and CaM-dependent protein kinase.
8376365 1993 Multiple phosphorylation of stathmin. Identification of four sites phosphorylated in intact cells and in vitro by cyclic AMP-dependent protein kinase and p34cdc2.
8248197 1993 Phosphorylation of the c-Fos transrepression domain by mitogen-activated protein kinase and 90-kDa ribosomal S6 kinase.
8226875 1993 Reciprocal regulation of mRNA and protein for subunits of cAMP-dependent protein kinase (RI alpha and C alpha) by cAMP in a neoplastic B cell line (Reh).
8182057 1994 cAMP- and cGMP-dependent protein kinase phosphorylation sites of the focal adhesion vasodilator-stimulated phosphoprotein (VASP) in vitro and in intact human platelets.
8163498 1994 Identification of the phosphorylation site in vitro for cAMP-dependent protein kinase on the rat adipocyte cGMP-inhibited cAMP phosphodiesterase.
8132598 1994 Phosphorylation of the inositol 1,4,5-trisphosphate receptor by cyclic GMP-dependent protein kinase.
8117614 1993 Differential expression of cyclic AMP-dependent protein kinase isozymes in normal human melanocytes and malignant melanomas.
8058338 1994 Protein kinase A phosphorylates cyclin D1 at three distinct sites within the cyclin box and at the C-terminus.
8027074 1994 Evidence for the importance of hydrophobic residues in the interactions between the cAMP-dependent protein kinase catalytic subunit and the protein kinase inhibitors.
8002936 1994 Molecular characterization of human stathmin expressed in Escherichia coli: site-directed mutagenesis of two phosphorylatable serines (Ser-25 and Ser-63).
7946090 1994 HIV Gag p17 protein impairs proliferation of normal lymphocytes in vitro.
7929424 1994 Interleukin-3 and bryostatin-1 mediate hyperphosphorylation of BCL2 alpha in association with suppression of apoptosis.
7905001 1994 Glutamic acid 203 of the cAMP-dependent protein kinase catalytic subunit participates in the inhibition by two isoforms of the protein kinase inhibitor.
7876254 1995 Characterization of Rad, a new member of Ras/GTPase superfamily, and its regulation by a unique GTPase-activating protein (GAP)-like activity.
7822264 1994 Identification of phosphorylation sites on glial fibrillary acidic protein for cdc2 kinase and Ca(2+)-calmodulin-dependent protein kinase II.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.
7759492 1995 Regulation of adenylyl cyclase by protein kinase A.
7706316 1995 Microtubule-associated protein/microtubule affinity-regulating kinase (p110mark). A novel protein kinase that regulates tau-microtubule interactions and dynamic instability by phosphorylation at the Alzheimer-specific site serine 262.
7688126 1993 Human immunodeficiency virus proteins induce the inhibitory cAMP/protein kinase A pathway in normal lymphocytes.
7615546 1995 Isoform cloning, actin binding, and chromosomal localization of human erythroid dematin, a member of the villin superfamily.
7566346 Hyperphosphorylation of tau in PHF.
7525582 1994 Phosphorylation of the desmoplakin COOH terminus negatively regulates its interaction with keratin intermediate filament networks.
7520867 1994 PTP-PEST: a protein tyrosine phosphatase regulated by serine phosphorylation.
6262777 1981 Complete amino acid sequence of the catalytic subunit of bovine cardiac muscle cyclic AMP-dependent protein kinase.
4092695 1985 Phosphorylation and activation of hamster carbamyl phosphate synthetase II by cAMP-dependent protein kinase. A novel mechanism for regulation of pyrimidine nucleotide biosynthesis.
3759968 1986 Sequence analysis of phospholamban. Identification of phosphorylation sites and two major structural domains.
2874140 1986 Identification of four phosphorylation sites in the N-terminal region of tyrosine hydroxylase.
2843813 1988 A cDNA clone encoding human cAMP-dependent protein kinase catalytic subunit C alpha.
2833520 1988 Phosphorylation of beta-glucuronidases from human normal liver and hepatoma by cAMP-dependent protein kinase.
2722853 1989 Phosphorylation modulates the activity of glycine N-methyltransferase, a folate binding protein. In vitro phosphorylation is inhibited by the natural folate ligand.
2548572 1989 Primary structure of the cAMP-dependent phosphorylation site of the plasma membrane calcium pump.
2504723 1989 Platelet glycoprotein Ib beta is phosphorylated on serine 166 by cyclic AMP-dependent protein kinase.
2500966 1989 Domain- and sequence-specific phosphorylation of vimentin induces disassembly of the filament structure.
2413024 1985 Studies on the phosphorylation of myelin basic protein by protein kinase C and adenosine 3':5'-monophosphate-dependent protein kinase.
2394752 1990 Protein kinase A phosphorylates retinal phosducin on serine 73 in situ.
2369897 1990 Regulation of HMG-CoA reductase: identification of the site phosphorylated by the AMP-activated protein kinase in vitro and in intact rat liver.
2176601 1990 Amino acid sequence of in vivo phosphorylation sites in the main intrinsic protein (MIP) of lens membranes.
2165385 1990 cAMP-dependent protein kinase: framework for a diverse family of regulatory enzymes.
2155236 1990 Phosphorylation sites linked to glial filament disassembly in vitro locate in a non-alpha-helical head domain.
2117608 1990 Phosphate groups as substrate determinants for casein kinase I action.
2114109 1990 Ca2(+)-calmodulin-dependent protein kinase II phosphorylates various types of non-epithelial intermediate filament proteins.
2108025 1990 Localization of phosphoserine residues in the alpha subunit of rabbit skeletal muscle phosphorylase kinase.
1978848 1990 HIV inhibits the early steps of lymphocyte activation, including initiation of inositol phospholipid metabolism.
1706595 1991 Endogenous cleavage of the Arg-379-Ala-380 bond in vitronectin results in a distinct conformational change which 'buries' Ser-378, its site of phosphorylation by protein kinase A.
1545828 1992 Alteration of a cyclic AMP-dependent protein kinase phosphorylation site in the c-Fos protein augments its transforming potential.
1406653 1992 Localization of the rap1GAP catalytic domain and sites of phosphorylation by mutational analysis.
1377674 1992 Phosphorylation of the cystic fibrosis transmembrane conductance regulator.
1375933 1992 Nitric oxide synthase regulatory sites. Phosphorylation by cyclic AMP-dependent protein kinase, protein kinase C, and calcium/calmodulin protein kinase; identification of flavin and calmodulin binding sites.
1375229 1992 Mechanism of interferon action. cDNA structure and regulation of a novel splice-site variant of the catalytic subunit of human protein kinase A from interferon-treated human cells.
1322130 1992 The two forms of bovine heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase result from alternative splicing.
1281154 1992 The dual role of the cAMP-dependent protein kinase C alpha subunit in T-cell receptor-triggered T-lymphocytes effector functions.
221492 1979 Sequence of two phosphorylated sites in the catalytic subunit of bovine cardiac muscle adenosine 3':5'-monophosphate-dependent protein kinase.
33381 1978 Direct phosphorylation of brain tyrosine hydroxylase by cyclic AMP-dependent protein kinase: mechanism of enzyme activation.