Property Summary

Ligand Count 17
NCBI Gene PubMed Count 480
PubMed Score 11.68
PubTator Score 163.77

Knowledge Summary

Patent (4,564)

TINX Plot

  Disease (7)

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma -1.500 3.2e-03
psoriasis -1.100 8.4e-03

Protein-protein Interaction (1)

PDB (33)

Gene RIF (223)

AA Sequence

MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHY      1 - 70
AMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFS     71 - 140
EPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEI    141 - 210
ILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTK    211 - 280
RFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSE    281 - 350
F//

Text Mined References (495)

PMID Year Title