Property Summary

NCBI Gene PubMed Count 141
PubMed Score 28.83
PubTator Score 40.05

Knowledge Summary

Patent (1,262)

TINX Plot

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.601 8.7e-07
group 4 medulloblastoma 1.200 2.4e-03
medulloblastoma, large-cell 1.200 8.0e-05
subependymal giant cell astrocytoma -1.160 4.0e-02
ovarian cancer 1.300 1.3e-05
Gaucher disease type 1 -1.600 3.3e-03

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
686923 other 8 / 0 / 2 In vitrocounter assay of key BMP4 Inhibitors

Gene RIF (112)

PMID Text
25940306 Salicylate activates the AMP-activated protein kinase (AMPK) by binding at the A-769662 drug binding site on the AMPK beta1-subunit
24602453 findings suggest that the reduced expression of AMPK-beta1 confers lower AMPK activity, which enhances the oncogenic capacity of advanced-stage ovarian cancer.
24414799 HIV-1 Tat-induced LTR transactivation is reversed by tanshinone II A through the AMPK-Nampt pathway
23515442 Data indicate that a diet high in iron improves glucose tolerance by activating AMPK through mechanisms that include deacetylation.
23396401 LKB1 controls IRS1-dependent adipogenesis via AMPK in white adipose tissue.
23266705 The effects of ethanol on AMPK and PP2A may result in activation of ChREBP, providing another potential mechanism for ethanol-induced hepatic steatosis.
22897928 Data indicate that except AMPK-alpha1, expressions of the other five AMPK subunits -alpha2, -beta1, -beta2, -gamma1 and -gamma2 are significantly higher in ovarian carcinomas.
22435535 Changes in translational control of mitochondrial proteins are signaled by the activation of AMPK and general control non-derepressible kinase 2 (GCN2), leading also to the activation of autophagy.
22363791 In breast cancer cells SESN2 is associated with AMPK.
22323564 Adipose tissues of markedly obese insulin resistant individuals uniformly show decreased AMPK activity and increased oxidative stress compared with insulin sensitive patients.
22105511 Adiponectin could attenuate renal dysfunction associated with mesangial cells disorders through AMPK-mTOR signal pathway.
22029423 AMPK, Akt and mTOR pathways have roles in resveratrol-enhanced prostate cancer cell response to ionizing radiation
22001850 Phosphorylation levels of AMPK and glycolysis were up-regulated to confer an advantage of survival for MERRF skin fibroblasts.
21907923 Inactivation of fumarate hydratase drives a metabolic shift to aerobic glycolysis in FH-de fi cient kidney tumors resulting in decreased levels of AMP-activated kinase.
21892142 Studies indicate that in most species, AMPK exists as an obligate heterotrimer, containing a catalytic subunit (alpha), and two regulatory subunits (beta and gamma).
21873433 NT5C1A suppression promotes AMP-activated protein kinase (AMPK) phosphorylation and metabolism in human and mouse skeletal muscle
21859551 LKB1-AMPK negatively regulated mTOR function in tumor.
21824431 1q21.1 copy number variant (CNV) results in gene function changes, specifically in the deletion containing lymphobalst cell lines, where AMPK was attenuated.
21670147 Findings reveal that hypoxia can trigger AMPK activation in the apparent absence of increased [AMP] through ROS-dependent CRAC channel activation, leading to increases in cytosolic calcium that activate the AMPK upstream kinase CaMKKbeta.
21651489 HIV-1 Tat-induced LTR transactivation is reversed by tanshinone II A through the AMPK-Nampt pathway
21619869 results of this study show that AMPK induces MUC5B expression through the p38 MAPK signaling pathway in airway epithelial cells.
21573174 Glucose restriction or treatment of human diploid fibroblasts (HDFs) with the activators of the AMPK/p53 pathway induced the expression of IFI16 protein.
21570709 Glucose deprivation resulted in activation of AMPK and inhibition of Akt phosphorylation
21554950 Androgen deprivation and hypoxia augmented AMPK activation and triggered autophagy in androgen-dependent prostate cancer cells.
21460634 Phosphorylation of AMPK by Ulk1 represents a negative feedback circuit.
21344388 HIV-1 Tat-induced LTR transactivation is reversed by tanshinone II A through the AMPK-Nampt pathway
21334384 The aim of this study was to investigate the effects of adiponectin on StAR protein expression, steroidogenic genes, and cortisol production and to dissect the signalling cascades involved in the activation of StAR expression.
21271224 High AMPK expression is associated with ovarian carcinoma.
21088205 Compared with slow-twitch fibers, there was less AMP-activated protein kinase (AMPK)-alpha(1) ( approximately 25%) and AMPK-beta(1) ( approximately 60%) in fast-twitch fibers from human skeletal muscle biopsies.
21072212 Results suggest that AMPK association with ULK1 plays an important role in autophagy induction.
21042744 There is a mutual suppressive interaction between AMPK and Akt.
20957377 AMPK is abnormally activated in tangle- and pre-tangle-bearing neurons in Alzheimer's disease and other tauopathies.
20810907 Data suggest that AMPK is required for the serum starvation-related increase in insulin-stimulated glucose transport, with ATM as a possible downstream effector.
20797423 Endoplasmic reticulum stress triggers suppression of AMPK while increasing C/EBPbeta and pCREB expression which activates PEPCK gene transcription.
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20668229 The LKB1/AMPK/TSC tumor suppressor axis is functional in acute myeloid leukemia.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20534808 These results suggest that the modification introduced by the laforin-malin complex could affect the subcellular distribution of AMPK beta subunits.
20534540 AMP-activated protein kinase inhibition mediates hepatitis C virus genome replication and lipid accumulation
20392842 HIV-1 Tat-induced LTR transactivation is reversed by tanshinone II A through the AMPK-Nampt pathway
20334581 These observations support a role for AMPK in the regulation of Na+-coupled glucose transport.
20231899 AMPK-mediated PLD1 activation is required for (14)C-glucose uptake through ERK stimulation
20196784 cisplatin-triggered activation of AMPK and subsequent suppression of mTOR activity can induce an autophagic response that protects tumour cells from cisplatin-mediated apoptotic death
20190568 The connections between AMPK and FoxO3A, are reviewed.
20177150 The nuclear translocation of GAPDH might be regulated by the PI3K signaling pathway acting mainly as a nuclear export signal and the AMPK signaling pathway acting as a nuclear import signal.
20107043 Data suggest that upregulation of adipose triglyceride lipase and suppression of hormone-sensitive lipase and AMP kinase signaling mediate high-fat diet-induced alterations in lipolysis and lipid utilization in adipocytes.
20103737 we will examine the evidence that AMP-activated protein kinase and SIRT1 both regulate each other and share many common target molecules--REVIEW
20083895 Data demonstrate that autophagy depends on the early activation of the AMP-activated protein kinase (AMPK)/mTOR-mediated pathway.
20019839 findings suggest that CCL2 hyperactivates mTORC1 through simultaneous regulation of both AMPK and Akt pathways and reveals a new network that promotes prostate cancer: CCL2-AMPK-mTORC1-survivin.
20018878 Data showed that HDL-induced activation of AMPK is dependent on both sphingosine 1-phosphate receptors and scavenger receptor class B type I.
19963029 Chlorophyll a up-regulated the AMPK and p-AMPK levels, and down-regulated the expression of PPAR-gamma.
19958286 Calmodulin-dependent protein kinase kinase-beta activates AMPK without forming a stable complex. There is a synergistic effects of Ca2+ and AMP.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19911004 It is necessary to clarify the tissue-specific and stress-specific activation mechanism of AMPK--REVIEW
19896469 These results indicate that AMPK activators facilitate the activation by TRAIL of an apoptotic cell death program through a mechanism independent of AMPK and dependent on the down-regulation of cFLIP levels.
19844168 AMPK is a novel and biologically significant participant with a tumor suppressive activity in the mitotic/cytokinetic phase of the cell cycle.
19843515 Data show that AMPK activation suppressed Ox-LDL-induced macrophage proliferation by suppressing GM-CSF expression and inducing cell cycle arrest.
19723334 AMPK phosphorylation and AMPK signalling are reduced in primary breast cancer.
19720090 HIV-1 Tat-induced LTR transactivation is reversed by tanshinone II A through the AMPK-Nampt pathway
19654324 These data show a novel role for AMPK, in concert with other signals induced by IFNgamma, in mediating reduced epithelial barrier function in a cell model of chronic intestinal inflammation.
19592618 AMPK activates FOXO3 by promoting its nuclear translocation by reducing reactive oxygen species levels.
19584313 Cellular polarity and energy metabolism are regulated through the conserved LKB1-AMPK signal transduction pathway.
19477172 inhibition of AMPK sensitizes cells to Fas-induced apoptosis via enhancement of ubiquitination and consequent proteasome degradation of the apoptosis inhibitory protein c-FLIP
19347029 Inactivation of AMPK alters gene expression and promotes growth of prostate cancer cells.
19225536 p53 activation may downregulate the AKT/mTOR pathway through a mechanism involving AMP kinase in mantle cell lymphoma
19211918 AMP-activated protein kinase inhibits alkaline pH- and PKA-induced apical vacuolar H+-ATPase accumulation in epididymal clear cells.
19112161 Brief intense interval exercise activates AMPK and p38 MAPK signaling and increases the expression of PGC-1alpha in human skeletal muscle.
19071085 These findings raise the possibility that glucose-induced changes in AMPK are linked to alterations in SIRT1 abundance and activity and possibly cellular redox state.
19050047 Regulation of erythrocyte survival by AMPK is reported.
19037093 AMPK controls the molecular mechanism underlying the differential biological functions of JNK, providing a novel explanation for the antiapoptotic role of LKB1.
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18836454 HIV-1 Tat-induced LTR transactivation is reversed by tanshinone II A through the AMPK-Nampt pathway
18729810 The proliferation potential of senescent human diploid fibroblasts can be modulated through the regulation of the AMPK signaling pathway.
18715874 AMP-activated protein kinase contributes to UV- and H2O2-induced apoptosis in human skin keratinocytes
18617528 Akt and AMPK have roles in the pathway of hydrogen peroxide-activated endothelial nitric-oxide synthase phosphorylation and function
18614968 Data suggest that increased expression of malonyl CoA decarboxylase, and the decreased expression of acetyl CoA carboxylase and 5'-AMP activated protein kinase are important regulators of the maturation of fatty acid oxidation in the newborn human heart.
18551130 Results report that oxygen deprivation can activate the autophagic pathway in human cancer cell lines via AMPK activity, independent of HIF-1, BNIP3, and BNIP3L.
18449856 UVB irradfiation regulates COX2 mRNA stability through AMPK and HuR in human keratinocytes.
18436530 modulating basal AMPK and CAMKKB activity in the hypothalamus is essential for maintaining tight regulation of pathways contributing to food intake
18328803 AMPK regulates the proteasomal activity under conditions of energy demand.
18258605 AMPK activity is a key determinant of HIF-1 functions in response to reactive oxygen species and may be involffed in HIF-1 regulatory mechanisms.
18250161 AMPK inhibits TGFbeta-induced transcription downstream of Smad3 COOH-terminal phosphorylation and nuclear translocation
18247380 the activities of AMP-activated protein kinase, protein kinase B, and mammalian target of rapamycin by limiting energy availability with 2-deoxyglucose
18184930 AMP-activated protein kinase (AMPK) regulates GLUT4 transcription through the histone deacetylase (HDAC)5 transcriptional repressor.
18184747 Inhibition of SIRT1 in telomerase-immortalized human cells and hematopoietic stem cells obtained from SIRT1-deficient mice enhanced cell growth under normal and nutrient limiting conditions.
18079111 findings show that that a beta1(186-270)gamma1 complex can form in the absence of detectable alpha subunit and that beta1 Thr-263 and Tyr-267 are required for betagamma association but not alphabeta association
18006825 metformin-mediated AMPK activation leads to inhibition of mTOR and a reduction in translation initiation
18006475 AMPK activated by fluid shear stress is a novel regulator of FoxO1a phosphorylation and protein levels.
17849173 Grb2 functions as a factor which mediates phosphorylation of AMPK at Thr172.
17711846 regulation of FOXO3 by AMPK may play a crucial role in fine tuning gene expression programs that control energy balance and stress resistance in cells throughout life
17669398 These results suggest that activation of AMPK inhibits multiple myeloma (MM) cell growth despite stimulation with IL-6, IGF-1, or HS-5 stromal cell conditioned medium and represents a potential new target in the therapy of MM.
17513605 5-Aminoimidazole-4-carboxamide riboside sensitizes TRAIL- and TNF{alpha}-induced cytotoxicity in colon cancer cells through AMP-activated protein kinase signaling
17459875 phosphatidylinositol 3-kinase/Akt signaling and induces apoptosis is inhibited by energy depletion via AMP-activated protein kinase-dependent phosphorylation of IRS-1 at Ser-794
17097050 AMPK mediates IL-2 production by regulating NF-AT and AP-1activation during T cell stimulation.
17054914 These findings suggest that the activation of JAK2, but not STAT3, may play a critical role in leptin-induced AMPK activation in Huh7 cells.
17028174 Results suggest that FLCN, mutated in Birt-Hogg-Dube syndrome, and its interacting partner FNIP1 may be involved in energy and/or nutrient sensing through the AMPK and mTOR signaling pathways.
17012231 analysis of a new model for AMPK heterotrimer structure where through its C terminus the beta-subunit binds to the alpha-subunit that, in turn, binds to the gamma-subunit
16953221 modulation of AMPK activity did not affect PI3K/AKT signalling, an advantage for the potential use of AMPK as a target for cancer therapy in LKB1 wild-type tumours
16949049 AMPK has a role in regulating growth of cultured human keratinocytes
16880506 Endothelial cells possess two pathways to activate AMPK, one Ca2+/CaMKKbeta dependent and one AMP/LKB1 dependent.
16873412 AMPK activation and a reduced phosphorylation of 4E-BP1 may contribute to the inhibition of muscle protein synthesis during resistance exercise.
16624523 AMPK phosphorylated TRIP6 in vitro at the N-terminus and the transcriptional co-activator properties of TRIP6 were enhanced by AMPK action.
16600998 In conclusion, during prolonged submaximal exercise at 60% VO2peak, higher fat oxidation in women cannot be explained by higher AMPK signalling.
16516166 These results show that AICAR and insulin/IGF-1 regulate VEGF expression through different mechanisms.
16505254 Observational study of gene-disease association. (HuGE Navigator)
16405649 These are the first data to show an effect of AMPK on cell movement, and suggest a fundamental role for energy deficiency in regulating cellular behaviour.
15896711 These results suggested that the combination of 5-FU and genistein exert a novel chemotherapeutic effect in colon cancers, and AMPK may be a regulatory molecule of COX-2 expression, further implying its involvement in cytotoxicity caused by genistein.
15886229 it is likely that the AMPK-GDE association is a novel mechanism regulating AMPK activity and the resultant fatty acid oxidation and glucose uptake
15769985 Reduced activation of AMPK by globular adiponectin in obese and obese type 2 diabetic subjects is not caused by reduced adiponectin receptor expression.
15694368 Dipyridamole, an adenosine transporter inhibitor, and 5'-amino-5'-deoxyadenosine, an adenosine kinase inhibitor, blocked the effect of AICAR on the down-regulation of the insulin receptor protein, mRNA, and promoter activity.
15289653 AMP-activated protein kinase has a role in gene expression in single islet beta-cells [review]

AA Sequence

MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVN      1 - 70
DKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEP     71 - 140
IVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHL    141 - 210
LQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI              211 - 270
//

Text Mined References (154)

PMID Year Title
25940306 2015 Salicylate activates AMPK and synergizes with metformin to reduce the survival of prostate and lung cancer cells ex vivo through inhibition of de novo lipogenesis.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
24602453 2014 Reduced expression of AMPK-?1 during tumor progression enhances the oncogenic capacity of advanced ovarian cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23515442 2013 Iron regulates glucose homeostasis in liver and muscle via AMP-activated protein kinase in mice.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23396401 2013 Liver kinase b1 is required for white adipose tissue growth and differentiation.
23266705 2013 Activation of carbohydrate response element-binding protein by ethanol.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22897928 2012 Over-expressions of AMPK subunits in ovarian carcinomas with significant clinical implications.
22435535 2012 AMPK and GCN2-ATF4 signal the repression of mitochondria in colon cancer cells.
22363791 2012 Sestrin2 modulates AMPK subunit expression and its response to ionizing radiation in breast cancer cells.
22323564 2012 Insulin sensitive and resistant obesity in humans: AMPK activity, oxidative stress, and depot-specific changes in gene expression in adipose tissue.
22105511 2012 Adiponectin inhibits PDGF-induced mesangial cell proliferation: regulation of mammalian target of rapamycin-mediated survival pathway by adenosine 5-monophosphate-activated protein kinase.
22029423 2011 Resveratrol enhances prostate cancer cell response to ionizing radiation. Modulation of the AMPK, Akt and mTOR pathways.
22001850 2012 AMPK-mediated increase of glycolysis as an adaptive response to oxidative stress in human cells: implication of the cell survival in mitochondrial diseases.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21907923 2011 The glycolytic shift in fumarate-hydratase-deficient kidney cancer lowers AMPK levels, increases anabolic propensities and lowers cellular iron levels.
21892142 2011 The AMPK signalling pathway coordinates cell growth, autophagy and metabolism.
21873433 2011 Suppression of 5'-nucleotidase enzymes promotes AMP-activated protein kinase (AMPK) phosphorylation and metabolism in human and mouse skeletal muscle.
21859551 2011 [Advances of LKB1-AMPK-mTOR Signaling Pathway in Tumor].
21824431 2011 Understanding the impact of 1q21.1 copy number variant.
21680840 2011 AMPK is a direct adenylate charge-regulated protein kinase.
21670147 2011 Hypoxia triggers AMPK activation through reactive oxygen species-mediated activation of calcium release-activated calcium channels.
21619869 2011 AMPK induces MUC5B expression via p38 MAPK in NCI-H292 airway epithelial cells.
21573174 2011 IFI16 induction by glucose restriction in human fibroblasts contributes to autophagy through activation of the ATM/AMPK/p53 pathway.
21570709 2011 Glucose deprivation activates AMPK and induces cell death through modulation of Akt in ovarian cancer cells.
21554950 2011 AMPK-mediated autophagy is a survival mechanism in androgen-dependent prostate cancer cells subjected to androgen deprivation and hypoxia.
21460634 2011 Ulk1-mediated phosphorylation of AMPK constitutes a negative regulatory feedback loop.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21334384 2011 Adiponectin (15-36) stimulates steroidogenic acute regulatory (StAR) protein expression and cortisol production in human adrenocortical cells: role of AMPK and MAPK kinase pathways.
21271224 2011 Prognostic impact of AMP-activated protein kinase expression in ovarian carcinoma: correlation of protein expression and GC/TOF-MS-based metabolomics.
21269460 2011 Initial characterization of the human central proteome.
21088205 2011 Enhanced technique to measure proteins in single segments of human skeletal muscle fibers: fiber-type dependence of AMPK-alpha1 and -beta1.
21072212 2010 The association of AMPK with ULK1 regulates autophagy.
21042744 2010 Regulation of mutual inhibitory activities between AMPK and Akt with quercetin in MCF-7 breast cancer cells.
20957377 2011 AMPK is abnormally activated in tangle- and pre-tangle-bearing neurons in Alzheimer's disease and other tauopathies.
20810907 2010 A role for AMPK in increased insulin action after serum starvation.
20797423 2011 C/EBP? is AMP kinase sensitive and up-regulates PEPCK in response to ER stress in hepatoma cells.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20668229 2010 The LKB1/AMPK signaling pathway has tumor suppressor activity in acute myeloid leukemia through the repression of mTOR-dependent oncogenic mRNA translation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20562859 2010 Network organization of the human autophagy system.
20534808 2010 The laforin-malin complex, involved in Lafora disease, promotes the incorporation of K63-linked ubiquitin chains into AMP-activated protein kinase beta subunits.
20534540 2010 Enhanced hepatitis C virus genome replication and lipid accumulation mediated by inhibition of AMP-activated protein kinase.
20334581 2010 Regulation of Na+-coupled glucose carrier SGLT1 by AMP-activated protein kinase.
20231899 2010 Phospholipase D1 mediates AMP-activated protein kinase signaling for glucose uptake.
20196784 2009 AMPK-mediated autophagy inhibits apoptosis in cisplatin-treated tumour cells.
20190568 2010 The AMPK-FoxO3A axis as a target for cancer treatment.
20177150 2010 Activation of AMP-activated protein kinase stimulates the nuclear localization of glyceraldehyde 3-phosphate dehydrogenase in human diploid fibroblasts.
20107043 2010 Dysregulation of lipolysis and lipid metabolism in visceral and subcutaneous adipocytes by high-fat diet: role of ATGL, HSL, and AMPK.
20103737 2010 AMPK and SIRT1: a long-standing partnership?
20083895 2010 Carcinoma cells activate AMP-activated protein kinase-dependent autophagy as survival response to kaempferol-mediated energetic impairment.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20019839 2009 CCL2 is a negative regulator of AMP-activated protein kinase to sustain mTOR complex-1 activation, survivin expression, and cell survival in human prostate cancer PC3 cells.
20018878 2010 Mechanism and role of high density lipoprotein-induced activation of AMP-activated protein kinase in endothelial cells.
19963029 2010 Chlorophyll a, an active anti-proliferative compound of Ludwigia octovalvis, activates the CD95 (APO-1/CD95) system and AMPK pathway in 3T3-L1 cells.
19958286 2010 Calmodulin-dependent protein kinase kinase-beta activates AMPK without forming a stable complex: synergistic effects of Ca2+ and AMP.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19911004 2010 The role of AMP-activated protein kinase in the cardiovascular system.
19896469 2010 AMPK-independent down-regulation of cFLIP and sensitization to TRAIL-induced apoptosis by AMPK activators.
19844168 2009 AMPK: Evidence for an energy-sensing cytokinetic tumor suppressor.
19843515 2009 Activation of AMP-activated protein kinase suppresses oxidized low-density lipoprotein-induced macrophage proliferation.
19723334 2009 Histological evaluation of AMPK signalling in primary breast cancer.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19654324 2009 AMP-activated protein kinase mediates the interferon-gamma-induced decrease in intestinal epithelial barrier function.
19592618 2009 Activation of the AMPK-FOXO3 pathway reduces fatty acid-induced increase in intracellular reactive oxygen species by upregulating thioredoxin.
19584313 2009 LKB1 and AMPK family signaling: the intimate link between cell polarity and energy metabolism.
19477172 2009 Down-regulation of AMP-activated protein kinase sensitizes DU145 carcinoma to Fas-induced apoptosis via c-FLIP degradation.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19347029 2009 Inactivation of AMPK alters gene expression and promotes growth of prostate cancer cells.
19225536 2009 Stabilization and activation of p53 downregulates mTOR signaling through AMPK in mantle cell lymphoma.
19211918 2009 AMP-activated protein kinase inhibits alkaline pH- and PKA-induced apical vacuolar H+-ATPase accumulation in epididymal clear cells.
19112161 2009 Brief intense interval exercise activates AMPK and p38 MAPK signaling and increases the expression of PGC-1alpha in human skeletal muscle.
19071085 2009 Concurrent regulation of AMP-activated protein kinase and SIRT1 in mammalian cells.
19050047 2009 Regulation of erythrocyte survival by AMP-activated protein kinase.
19037093 2009 AMP kinase signaling determines whether c-Jun N-terminal kinase promotes survival or apoptosis during glucose deprivation.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18729810 2008 Lysophosphatidic acid and adenylyl cyclase inhibitor increase proliferation of senescent human diploid fibroblasts by inhibiting adenosine monophosphate-activated protein kinase.
18715874 2008 AMP-activated protein kinase contributes to UV- and H2O2-induced apoptosis in human skin keratinocytes.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18624398 2008 Protein interaction data set highlighted with human Ras-MAPK/PI3K signaling pathways.
18617528 2008 Bidirectional actions of hydrogen peroxide on endothelial nitric-oxide synthase phosphorylation and function: co-commitment and interplay of Akt and AMPK.
18614968 2008 Myocardial hypertrophy and the maturation of fatty acid oxidation in the newborn human heart.
18551130 2008 Hypoxia signals autophagy in tumor cells via AMPK activity, independent of HIF-1, BNIP3, and BNIP3L.
18480843 2008 Downregulation of AMP-activated protein kinase by Cidea-mediated ubiquitination and degradation in brown adipose tissue.
18449856 2008 UVB irradiation regulates Cox-2 mRNA stability through AMPK and HuR in human keratinocytes.
18439900 2008 AMPK phosphorylation of raptor mediates a metabolic checkpoint.
18436530 2008 Muscarinic receptor activation of AMP-activated protein kinase inhibits orexigenic neuropeptide mRNA expression.
18403135 2008 Identification and characterization of a novel folliculin-interacting protein FNIP2.
18328803 2008 Role of AMP-activated protein kinase in autophagy and proteasome function.
18258605 2008 Reactive oxygen species stabilize hypoxia-inducible factor-1 alpha protein and stimulate transcriptional activity via AMP-activated protein kinase in DU145 human prostate cancer cells.
18250161 2008 AMP-activated protein kinase inhibits transforming growth factor-beta-induced Smad3-dependent transcription and myofibroblast transdifferentiation.
18247380 2008 Modulation of the activities of AMP-activated protein kinase, protein kinase B, and mammalian target of rapamycin by limiting energy availability with 2-deoxyglucose.
18184930 2008 AMP-activated protein kinase regulates GLUT4 transcription by phosphorylating histone deacetylase 5.
18184747 2008 SIRT1 acts as a nutrient-sensitive growth suppressor and its loss is associated with increased AMPK and telomerase activity.
18088087 2008 Phosphoproteome of resting human platelets.
18079111 2008 AMP-activated protein kinase subunit interactions: beta1:gamma1 association requires beta1 Thr-263 and Tyr-267.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18006825 2007 Metformin inhibits mammalian target of rapamycin-dependent translation initiation in breast cancer cells.
18006475 2008 Shear stress-induced activation of the AMP-activated protein kinase regulates FoxO1a and angiopoietin-2 in endothelial cells.
17849173 2008 The function study on the interaction between Grb2 and AMPK.
17712357 2007 AMP-activated/SNF1 protein kinases: conserved guardians of cellular energy.
17711846 2007 The energy sensor AMP-activated protein kinase directly regulates the mammalian FOXO3 transcription factor.
17669398 2007 Activation of adenosine monophosphate activated protein kinase inhibits growth of multiple myeloma cells.
17513605 2007 5-Aminoimidazole-4-carboxamide riboside sensitizes TRAIL- and TNF{alpha}-induced cytotoxicity in colon cancer cells through AMP-activated protein kinase signaling.
17459875 2007 Energy depletion inhibits phosphatidylinositol 3-kinase/Akt signaling and induces apoptosis via AMP-activated protein kinase-dependent phosphorylation of IRS-1 at Ser-794.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17307971 2007 AMP-activated protein kinase in metabolic control and insulin signaling.
17097050 2006 Inhibition of AMP-activated protein kinase suppresses IL-2 expression through down-regulation of NF-AT and AP-1 activation in Jurkat T cells.
17054914 2006 Leptin activates AMP-activated protein kinase in hepatic cells via a JAK2-dependent pathway.
17028174 2006 Folliculin encoded by the BHD gene interacts with a binding protein, FNIP1, and AMPK, and is involved in AMPK and mTOR signaling.
17012231 2006 A revised model for AMP-activated protein kinase structure: The alpha-subunit binds to both the beta- and gamma-subunits although there is no direct binding between the beta- and gamma-subunits.
16953221 2007 Dysfunctional AMPK activity, signalling through mTOR and survival in response to energetic stress in LKB1-deficient lung cancer.
16949049 2006 AMPK regulation of the growth of cultured human keratinocytes.
16880506 2006 Thrombin activates AMP-activated protein kinase in endothelial cells via a pathway involving Ca2+/calmodulin-dependent protein kinase kinase beta.
16873412 2006 Resistance exercise increases AMPK activity and reduces 4E-BP1 phosphorylation and protein synthesis in human skeletal muscle.
16624523 2006 TRIP6 transcriptional co-activator is a novel substrate of AMP-activated protein kinase.
16600998 2006 Higher skeletal muscle alpha2AMPK activation and lower energy charge and fat oxidation in men than in women during submaximal exercise.
16541075 2006 The finished DNA sequence of human chromosome 12.
16516166 2006 AMPK activation inhibits the expression of HIF-1alpha induced by insulin and IGF-1.
16505254 2006 Haplotype structures and large-scale association testing of the 5' AMP-activated protein kinase genes PRKAA2, PRKAB1, and PRKAB2 [corrected] with type 2 diabetes.
16405649 2006 Activators of the energy sensing kinase AMPK inhibit random cell movement and chemotaxis in U937 cells.
16306228 2005 14-3-3 cooperates with LKB1 to regulate the activity and localization of QSK and SIK.
16054041 2005 AMP-activated protein kinase: ancient energy gauge provides clues to modern understanding of metabolism.
15896711 2005 Combination of 5-fluorouracil and genistein induces apoptosis synergistically in chemo-resistant cancer cells through the modulation of AMPK and COX-2 signaling pathways.
15886229 2005 Glycogen debranching enzyme association with beta-subunit regulates AMP-activated protein kinase activity.
15769985 2005 Impaired activation of AMP-kinase and fatty acid oxidation by globular adiponectin in cultured human skeletal muscle of obese type 2 diabetics.
15694368 2005 AICAR, an activator of AMP-activated protein kinase, down-regulates the insulin receptor expression in HepG2 cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15289653 2004 Imaging glucose-regulated insulin secretion and gene expression in single islet beta-cells: control by AMP-activated protein kinase.
15122253 2004 Hot-spot residue in small heat-shock protein 22 causes distal motor neuropathy.
15058305 2004 AMP-kinase regulates food intake by responding to hormonal and nutrient signals in the hypothalamus.
15028725 2004 C75, a fatty acid synthase inhibitor, reduces food intake via hypothalamic AMP-activated protein kinase.
14985505 2004 The tumor suppressor LKB1 kinase directly activates AMP-activated kinase and regulates apoptosis in response to energy stress.
14985344 2004 Inhibition of inducible nitric-oxide synthase by activators of AMP-activated protein kinase: a new mechanism of action of insulin-sensitizing drugs.
14742438 2004 AMP-activated protein kinase plays a role in the control of food intake.
14729328 2004 The AMP-activated protein kinase cascade--a unifying system for energy control.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14651849 2003 TSC2 mediates cellular energy response to control cell growth and survival.
14615481 2004 C75, a fatty acid synthase inhibitor, modulates AMP-activated protein kinase to alter neuronal energy metabolism.
12958172 2003 The AMP-activated protein kinase activator AICAR does not induce GLUT4 translocation to transverse tubules but stimulates glucose uptake and p38 mitogen-activated protein kinases alpha and beta in skeletal muscle.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10760274 2000 Role of AMP-activated protein kinase in the regulation by glucose of islet beta cell gene expression.
10698692 2000 Characterization of AMP-activated protein kinase gamma-subunit isoforms and their role in AMP binding.
9575201 1998 Identification of a novel AMP-activated protein kinase beta subunit isoform that is highly expressed in skeletal muscle.
9305909 1997 Posttranslational modifications of the 5'-AMP-activated protein kinase beta1 subunit.
9224708 1997 AMP-activated protein kinase isoenzyme family: subunit structure and chromosomal location.
8663446 1996 Regulation of 5'-AMP-activated protein kinase activity by the noncatalytic beta and gamma subunits.
8626596 1996 Characterization of AMP-activated protein kinase beta and gamma subunits. Assembly of the heterotrimeric complex in vitro.
8621499 1996 Non-catalytic beta- and gamma-subunit isoforms of the 5'-AMP-activated protein kinase.
8557660 1996 Mammalian AMP-activated protein kinase subfamily.