Property Summary

NCBI Gene PubMed Count 121
PubMed Score 18.57
PubTator Score 779.17

Knowledge Summary

Patent (2,708)

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.900 1.9e-02
ependymoma -2.200 8.9e-03
oligodendroglioma -2.300 1.7e-02
glioblastoma -2.100 4.0e-04
medulloblastoma -2.100 3.1e-03
atypical teratoid / rhabdoid tumor -1.900 1.4e-04
medulloblastoma, large-cell -1.200 4.9e-03
lung cancer 1.400 2.1e-03
interstitial cystitis -1.200 1.6e-02
adult high grade glioma -2.000 2.3e-04
lung carcinoma 1.200 4.4e-12

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (92)

PMID Text
26831516 These data are in accordance with R6 binding directly to AMPKbeta2 when both proteins detach from the diminishing glycogen particle, which is simultaneous with increased AMPKbeta2 Thr-148 autophosphorylation.
26427488 Data show that activated AMP-activated protein kinase (AMPK) limits retinal pigment epithelial cells (RPE) phagocytic activity by abolishing retinal photoreceptor cell outer segment (POS)-induced activation of c-mer proto-oncogene tyrosine kinase (MerTK).
26374855 AMPK-alpha-2 binds to ER-alpha, as well as ER-beta.
26351140 A subunit composition of AMPK (alpha2beta2gamma1) is preferred for colorectal cancer cell survival, at least in part, by stabilizing the tumor-specific expression of PGC1B.
26337566 p-AMPKalpha was associated with cervical carcinogenesis, and high expression of AMPKalpha2 was correlated with better disease-free survival in patients with early-stage cervical cancer
26108355 AMPKalpha signalling suppresses EMT and secretion of chemokines in renal tubular epithelia through interaction with CK2beta to attenuate renal injury.
25858560 Data (including data from studies in knockout mice) suggest AMPK activation (AMPKa1 or AMPKa2) suppresses inflammation in vascular smooth muscle cells by down-regulation of STAT1 signaling and up-regulation of MKP-1 (dual specificity phosphatase 1).
25846811 The basal level of ERK phosphorylation was suppressed in cells treated with siRNA against PRKAA2 (AMPK-knockdown cells).
25840010 These data define the master metabolic regulator AMPK as a novel stress granule constituent that also controls their biogenesis.
25799226 AMPKalpha2 is an essential mediator of nicotine-induced whole-body IR in spite of reductions in adiposity
25687571 AMPK-alpha co-immunoprecipitates with insulin receptor(IR). The compartmentalization of AMPK-alpha between plasma membrane and Golgi/endosomes fractions in rat's liver is insulin-dependent. Insulin receptor internalization was markedly decreased after AMPK-alpha2 knockdown, and treatment with the ATIC substrate AICAR, which is an allosteric activator of AMPK, increased IR endocytosis in human cultured cells and rat liver.
25590814 CaMKKbeta-AMPKalpha2 signaling contributes to mitotic Golgi fragmentation and the G2/M transition in mammalian cells.
24414799 HIV-1 Tat-induced LTR transactivation is reversed by tanshinone II A through the AMPK-Nampt pathway
23723070 Data indicate that AMP-dependent kinases (AMPKalpha1 and AMPKalpha2) inhibit caveolin-1 phosphorylation by stabilizing the interaction between c-Abl and Prdx-1.
23476055 AMPKalpha2 suppresses endothelial ACE expression via phosphorylation of p53 and upregulation of microRNA-143/145.
23396962 High PRKAA2 expression is associated with follicular lymphoma.
23293026 WWP1 down-regulates AMPKalpha2 under high glucose culture conditions via the ubiquitin-proteasome pathway
23000302 Exercise training increased AMPKalpha1 activity in older men, however, AMPKalpha2 activity, and the phosphorylation of AMPK, ACC and mTOR, were not affected
22897928 Data indicate that except AMPK-alpha1, expressions of the other five AMPK subunits -alpha2, -beta1, -beta2, -gamma1 and -gamma2 are significantly higher in ovarian carcinomas.
22728651 underexpression of AMPK is frequently observed in HCC, and that inactivation of AMPK promotes hepatocarcinogenesis by destabilizing p53 in a SIRT1-dependent manner.
22305490 The results of this study demonistrated that the novel findings that intronic SNPs in the genes coding for the catalytic alpha2 (PRKAA2) of AMPK are associated with antipsychotic-induced weight gain in schizophrenia or schizoaffective disorder patients
22212710 AMPK activation could effectively decrease PDGF-induced HuR cytoplasmatic translocation.
22137581 The AMPK coordinates nutrient status with mitosis completion, which may be critical for the organism's response to low nutrients during development, or in adult stem and cancer cells.
21825219 AMP activated protein kinase-alpha2 regulates expression of estrogen-related receptor-alpha, a metabolic transcription factor related to heart failure development.
21673972 IKK is a direct substrate of AMPKalpha2
21651489 HIV-1 Tat-induced LTR transactivation is reversed by tanshinone II A through the AMPK-Nampt pathway
21543851 The crystal structure of the phosphorylated-state mimic T172D mutant kinase domain from the human AMPK alpha2 subunit is reported in the apo form and in complex with a selective inhibitor, compound C.
21432774 AMPKalpha2 expression clearly dominates in skeletal myocytes and cardiomyocytes, whereas AMPKalpha1 dominates in a number of secreting cells, like mammary glands, islets of langerhans and cells of the colon crypt
21344388 HIV-1 Tat-induced LTR transactivation is reversed by tanshinone II A through the AMPK-Nampt pathway
21209024 These results suggest that insulin may be required for insulin to activate alpha1 and alpha2 AMPK subunits in the human ovary.
20876741 AMP-activated protein kinase (PRKAA1/2, aka AMPK) mediates the stress-induced proteasome-dependent loss of ID2 at high stress levels.
20821366 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20682687 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20647423 AMPK activates transcription by direct association with chromatin and phosphorylation of histone H2B at ser36; results place AMPK-dependent H2B Ser36 phosphorylation in direct transcriptional and chromatin regulatory pathway leading to stress adaptation
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20602615 Observational study of gene-disease association. (HuGE Navigator)
20558612 AMPKalpha2-by affecting Fyn phosphorylation and activity-plays a key role in platelet alphaIIbbeta3 integrin signaling, leading to clot retraction and thrombus stability
20392842 HIV-1 Tat-induced LTR transactivation is reversed by tanshinone II A through the AMPK-Nampt pathway
20217115 Sprint exercise 60 min after glucose ingestion elicits an immediate Ser485-AMPKalpha1/Ser491-AMPKalpha2 phosphorylation.
20167927 AMPKalpha2 functions as a physiological suppressor of NAD(P)H oxidase, ROS production and 26S proteasome activity in endothelial cells.
20124121 AMPK functions as a physiological suppressor of endoplasmic reticulum stress by maintaining SERCA activity and intracellular Ca2+ homeostasis.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19836452 Purification and characterization of truncated human AMPK alpha 2 beta 2 gamma 3 heterotrimer from baculovirus-infected insect cells
19728147 These results indicate that AMP-activated protein kinase supports the NGF-induced viability of human HeLa cells to glucose starvation.
19723084 Data suggest that genistein in combination with capsaicin exerts anti-inflammatory and anticarcinogenic properties through the modulation of AMPK and COX-2 and possibly various mitogen-activated protein kinases synergistically or nonsynergistically.
19720831 a novel signaling pathway inhibits hepatic gluconeogenesis through HGF/AMPK/USF-1/SHP
19720090 HIV-1 Tat-induced LTR transactivation is reversed by tanshinone II A through the AMPK-Nampt pathway
19574280 Variants in genes for AMPKalpha2 and AMPKgamma3 were not associated with PCOS or its component traits.
19528236 Results suggest that the mechanism by which PTP1B regulates adiposity and leptin sensitivity likely involves the coordinated regulation of AMPK in hypothalamus and peripheral tissues.
19502591 Results suggest that fatty acids and ER stress reduce AdipoR2 protein and pAMPK levels.
19470831 Treatment with globular adiponectin significantly reduced simulated ischemia-reperfusion injury induced apoptosis in WT cardiomyocytes as well as in AMPK-alpha2 dominant negative cardiomyocytes.
19440859 resistin induces insulin resistance in HepG2 cells at least partly via induction of SOCS-3 expression and reduction of Akt phosphorylation through an AMPK-independent mechanism
19434633 Inhibition of de novo purine synthesis in human prostate cells results in ATP depletion, AMPK and p53 activation, and induces senescence.
19170765 The phosphorylation of GFAT1 at Ser243 by AMPK has an important role in the regulation of the GFAT1 enzymatic activity.
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18974883 A novel AMPK-mediated regulatory pathway that regulates PGC-1alpha gene expression.
18836454 HIV-1 Tat-induced LTR transactivation is reversed by tanshinone II A through the AMPK-Nampt pathway
18801964 Results demonstrate that AMPK-alpha1 and AMPK-alpha2 activity and fuel selection in skeletal muscle in response to exercise can be manipulated by diet and/or the interactive effects of diet and exercise training.
18614941 AMPK alpha2 activity, AMPK alpha2 Thr172 phosphorylation, and ACC-beta Ser222 phosphorylation were increased immediately after exercise. These increases had all returned to basal levels at 3 and 24 h after exercise.
18195011 alpha2 But not alpha1 AMP-activated protein kinase mediates oxidative stress-induced inhibition of retinal pigment epithelium cell phagocytosis of photoreceptor outer segments
17950019 genetic variants of LKB1-AMPK-TORC2 pathway components may exert a weak influence on the occurrence of type 2 diabetes in Japanese
17950019 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17179156 AMPK has a central role in stimulus-response coupling by hypoxia
16984726 AA454543 may have a role in progression of hepatocellular carcinoma after partial hepatectomy
16801347 Observational study of gene-disease association. (HuGE Navigator)
16670154 Findings indicate that AMPK activation in skeletal muscle during exercise is not sensitive to changes in plasma glucose levels in the normal range.
16598851 Oral glucose ingestion attenuates the exercise-induced activation of alpha2-AMPK, bringing further support for a fuel-sensing role of AMPK in skeletal muscle.
16567511 Observational study of gene-disease association. (HuGE Navigator)
16567511 PRKAA2 gene influences insulin resistance and susceptibility to type 2 diabetes in the Japanese population.
16518831 These data suggest that prolonged hypoxia promotes the expression and functional activation of AMPKalpha2 and VEGF production in glioma cell lines and glioblastoma multiform tumors, thus contributing to tumor survival and angiogenesis in gliomas.
16505254 Observational study of gene-disease association. (HuGE Navigator)
16483872 data suggest that moderate endurance exercise promotes glucose transport, GLUT4 expression, and insulin sensitivity in skeletal muscle at least partially via activation of the alpha2 isoform of AMPK
16275868 causes inappropriate AMP kinase activation, which leads to glycogen accumulation and heart conduction system disease when transfected into mice
16054096 Overexpression of CaMKKbeta in mammalian cells increases AMPK activity, whereas pharmacological inhibition of CaMKK, or downregulation of CaMKKbeta using RNA interference, almost completely abolishes AMPK activation
16054095 There is a significant basal activity and phosphorylation of AMPK in LKB1-deficient cells that can be stimulated by Ca2+ ionophores, and studies using the CaMKK inhibitor STO-609 and isoform-specific siRNAs show that CaMKKbeta is required for this effect
15640157 AMPK has a major role in the post-transcriptional regulation of VEGF and a potential role in tumor angiogenesis
15572372 AMPK has a role in the phenobarbital induction of CYP2B gene expression
15371448 Results indicate that AMP-activated protein kinase (AMPK)alpha negatively regulates acetyl-CoA carboxylase activity and hepatic lipid content.
15297373 AMPK is a novel and critical component of HIF-1 regulation, implying its involvement in vanadate-induced prostate carcinogenesis
15231718 AMPK is a major regulator of skeletal muscle HSL activity that can override beta-adrenergic stimulation
14709557 AMPK and eEF2 kinase may provide a key link between cellular energy status and the inhibition of protein synthesis, a major consumer of metabolic energy
14613924 This study demonstrates that protein content and basal AMPK activity in human skeletal muscle are highly susceptible to endurance exercise training.
12941758 Acetyl-CoA carboxylase beta phosphorylation is especially sensitive to exercise and tightly coupled to AMPK signaling and that AMPK activation does not depend on AMPK kinase activation during exercise.
12847291 LKB1 kinase, which is associated with Peutz-Jeghers cancer-susceptibility syndrome, phosphorylates and activates AMPK in vitro.
12788940 endothelial AMPK signaling may be a critical determinant of blood vessel recruitment to tissues that are subjected to ischemic stress.
12663462 results suggest that nuclear translocation of 5' AMP-activated protein kinase might mediate the effects of exercise on skeletal muscle gene and protein expression
12519745 Overexpression of mutant AMPK-alpha1 enhanced forskolin-stimulated I short-circuit currents, consistent with dominant-negative reduction in inhibition of CFTR by endogenous AMPK.
12427743 Regulation of channel gating by AMP-activated protein kinase modulates cystic fibrosis transmembrane conductance regulator activity in lung submucosal cells.
12413941 AMPK signaling is not a key regulatory system of muscle substrate combustion during prolonged exercise and marked activation of AMPK via phosphorylation is not sufficient to maintain an elevated ACCbeta Ser(221) phosphorylation during prolonged exercise
12091379 Role of AMPK in tolerance to glucose starvation in cell lines
12067722 Hepatic amino acid-dependent signaling is under the control of AMP-dependent protein kinase.

AA Sequence

MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGKIKREIQNLKL      1 - 70
FRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARRLFQQILSAVDYCHRHMVVHRDL     71 - 140
KPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSCGVILYALLCG    141 - 210
TLPFDDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPED    211 - 280
PSYDANVIDDEAVKEVCEKFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGS    281 - 350
FMDDSAMHIPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAEVY    351 - 420
RAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSC    421 - 490
SAAGLHRPRSSFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTLAR            491 - 552
//

Text Mined References (145)

PMID Year Title
26831516 2016 The interaction between AMPK?2 and the PP1-targeting subunit R6 is dynamically regulated by intracellular glycogen content.
26427488 2016 Blockade of MerTK Activation by AMPK Inhibits RPE Cell Phagocytosis.
26374855 2015 Oestrogen receptors interact with the ?-catalytic subunit of AMP-activated protein kinase.
26351140 2015 AMPK Promotes Aberrant PGC1? Expression To Support Human Colon Tumor Cell Survival.
26337566 2015 Prognostic Significance of AMP-Dependent Kinase Alpha Expression in Cervical Cancer.
26108355 2015 AMPK?2 reduces renal epithelial transdifferentiation and inflammation after injury through interaction with CK2?.
25858560 2015 AMPK Suppresses Vascular Inflammation In Vivo by Inhibiting Signal Transducer and Activator of Transcription-1.
25846811 2015 Negative regulation of the LKB1/AMPK pathway by ERK in human acute myeloid leukemia cells.
25840010 2015 5'-AMP-activated protein kinase alpha regulates stress granule biogenesis.
25799226 2015 Activation of AMPK?2 in adipocytes is essential for nicotine-induced insulin resistance in vivo.
25687571 2015 The last enzyme of the de novo purine synthesis pathway 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase (ATIC) plays a central role in insulin signaling and the Golgi/endosomes protein network.
25590814 2015 CaMKK?-AMPK?2 signaling contributes to mitotic Golgi fragmentation and the G2/M transition in mammalian cells.
25416956 2014 A proteome-scale map of the human interactome network.
25126726 2014 FLCN, a novel autophagy component, interacts with GABARAP and is regulated by ULK1 phosphorylation.
23723070 2013 AMP-dependent kinase inhibits oxidative stress-induced caveolin-1 phosphorylation and endocytosis by suppressing the dissociation between c-Abl and Prdx1 proteins in endothelial cells.
23476055 2013 AMP-activated protein kinase regulates endothelial cell angiotensin-converting enzyme expression via p53 and the post-transcriptional regulation of microRNA-143/145.
23396962 2013 Association of AMP-activated protein kinase with risk and progression of non-Hodgkin lymphoma.
23293026 2013 E3 ubiquitin ligase, WWP1, interacts with AMPK?2 and down-regulates its expression in skeletal muscle C2C12 cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23088624 2013 N-Myristoylation is essential for protein phosphatases PPM1A and PPM1B to dephosphorylate their physiological substrates in cells.
23000302 Reduced AMPK-ACC and mTOR signaling in muscle from older men, and effect of resistance exercise.
22897928 2012 Over-expressions of AMPK subunits in ovarian carcinomas with significant clinical implications.
22797923 2012 ZNRF2 is released from membranes by growth factors and, together with ZNRF1, regulates the Na+/K+ATPase.
22728651 2012 AMPK promotes p53 acetylation via phosphorylation and inactivation of SIRT1 in liver cancer cells.
22517326 2012 The ancient drug salicylate directly activates AMP-activated protein kinase.
22305490 2012 Association study between variants of AMP-activated protein kinase catalytic and regulatory subunit genes with antipsychotic-induced weight gain.
22286170 2012 The combination of a genome-wide association study of lymphocyte count and analysis of gene expression data reveals novel asthma candidate genes.
22212710 2012 PDGF-induced airway smooth muscle proliferation is associated with Human antigen R activation and could be weakened by AMPK activation.
22137581 2011 Chemical genetic screen for AMPK?2 substrates uncovers a network of proteins involved in mitosis.
21825219 2011 AMP activated protein kinase-?2 regulates expression of estrogen-related receptor-?, a metabolic transcription factor related to heart failure development.
21673972 2011 Nitric oxide-induced activation of the AMP-activated protein kinase ?2 subunit attenuates I?B kinase activity and inflammatory responses in endothelial cells.
21543851 2011 Structural basis for compound C inhibition of the human AMP-activated protein kinase ?2 subunit kinase domain.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21460634 2011 Ulk1-mediated phosphorylation of AMPK constitutes a negative regulatory feedback loop.
21432774 2011 Different expression of the catalytic alpha subunits of the AMP activated protein kinase--an immunohistochemical study in human tissue.
21269460 2011 Initial characterization of the human central proteome.
21209024 2011 Phosphorylation and activation of AMP-activated protein kinase (AMPK) by metformin in the human ovary requires insulin.
21205641 2011 Phosphorylation of ULK1 (hATG1) by AMP-activated protein kinase connects energy sensing to mitophagy.
20876741 2010 Cellular stress causes reversible, PRKAA1/2-, and proteasome-dependent ID2 protein loss in trophoblast stem cells.
20821366 2011 Association study of energy homeostasis genes and antipsychotic-induced weight gain in patients with schizophrenia.
20801214 2011 Ppm1E is an in cellulo AMP-activated protein kinase phosphatase.
20682687 2010 Common variants in 40 genes assessed for diabetes incidence and response to metformin and lifestyle intervention in the diabetes prevention program.
20647423 2010 Signaling kinase AMPK activates stress-promoted transcription via histone H2B phosphorylation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
20562859 2010 Network organization of the human autophagy system.
20558612 2010 AMPK ?2 subunit is involved in platelet signaling, clot retraction, and thrombus stability.
20217115 2010 SIRT1, AMP-activated protein kinase phosphorylation and downstream kinases in response to a single bout of sprint exercise: influence of glucose ingestion.
20167927 2010 AMPKalpha2 deletion causes aberrant expression and activation of NAD(P)H oxidase and consequent endothelial dysfunction in vivo: role of 26S proteasomes.
20160076 2010 ATM signals to TSC2 in the cytoplasm to regulate mTORC1 in response to ROS.
20124709 2010 A conserved mechanism of autoinhibition for the AMPK kinase domain: ATP-binding site and catalytic loop refolding as a means of regulation.
20124121 2010 Reduction of AMP-activated protein kinase alpha2 increases endoplasmic reticulum stress and atherosclerosis in vivo.
20074060 2010 Cell-wide analysis of secretory granule dynamics in three dimensions in living pancreatic beta-cells: evidence against a role for AMPK-dependent phosphorylation of KLC1 at Ser517/Ser520 in glucose-stimulated insulin granule movement.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19836452 2010 Purification and characterization of truncated human AMPK alpha 2 beta 2 gamma 3 heterotrimer from baculovirus-infected insect cells.
19728147 2010 AMP-activated protein kinase supports the NGF-induced viability of human HeLa cells to glucose starvation.
19723084 2009 Anti-inflammatory and anticarcinogenic effect of genistein alone or in combination with capsaicin in TPA-treated rat mammary glands or mammary cancer cell line.
19720831 2009 Hepatocyte growth factor family negatively regulates hepatic gluconeogenesis via induction of orphan nuclear receptor small heterodimer partner in primary hepatocytes.
19574280 2009 Association study of AMP-activated protein kinase subunit genes in polycystic ovary syndrome.
19528236 2009 Neuronal protein tyrosine phosphatase 1B deficiency results in inhibition of hypothalamic AMPK and isoform-specific activation of AMPK in peripheral tissues.
19502591 2009 Fenofibrate and PBA prevent fatty acid-induced loss of adiponectin receptor and pAMPK in human hepatoma cells and in hepatitis C virus-induced steatosis.
19470831 2009 Cardioprotective effect of adiponectin is partially mediated by its AMPK-independent antinitrative action.
19440859 2009 Resistin induces insulin resistance by both AMPK-dependent and AMPK-independent mechanisms in HepG2 cells.
19434633 2009 Inhibition of de novo purine synthesis in human prostate cells results in ATP depletion, AMPK activation and induces senescence.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19170765 2009 AMP-activated protein kinase phosphorylates glutamine : fructose-6-phosphate amidotransferase 1 at Ser243 to modulate its enzymatic activity.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18974883 2008 AMP-activated protein kinase-regulated activation of the PGC-1alpha promoter in skeletal muscle cells.
18801964 2008 Fat adaptation followed by carbohydrate restoration increases AMPK activity in skeletal muscle from trained humans.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18674809 2008 AMPK and PPARdelta agonists are exercise mimetics.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18614941 2008 Acute exercise does not cause sustained elevations in AMPK signaling or expression.
18439900 2008 AMPK phosphorylation of raptor mediates a metabolic checkpoint.
18195011 2008 alpha2 But not alpha1 AMP-activated protein kinase mediates oxidative stress-induced inhibition of retinal pigment epithelium cell phagocytosis of photoreceptor outer segments.
18184930 2008 AMP-activated protein kinase regulates GLUT4 transcription by phosphorylating histone deacetylase 5.
17950019 2008 Single nucleotide polymorphisms in genes encoding LKB1 (STK11), TORC2 (CRTC2) and AMPK alpha2-subunit (PRKAA2) and risk of type 2 diabetes.
17712357 2007 AMP-activated/SNF1 protein kinases: conserved guardians of cellular energy.
17711846 2007 The energy sensor AMP-activated protein kinase directly regulates the mammalian FOXO3 transcription factor.
17486097 2007 Energy-dependent regulation of cell structure by AMP-activated protein kinase.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17307971 2007 AMP-activated protein kinase in metabolic control and insulin signaling.
17179156 2007 AMP-activated protein kinase mediates carotid body excitation by hypoxia.
16984726 2006 Preoperative plasma transcript AA454543 level is an independent prognostic factor for hepatocellular carcinoma after partial hepatectomy.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16801347 2006 AMP-kinase alpha2 subunit gene PRKAA2 variants are associated with total cholesterol, low-density lipoprotein-cholesterol and high-density lipoprotein-cholesterol in normal women.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16670154 2006 Carbohydrate ingestion does not alter skeletal muscle AMPK signaling during exercise in humans.
16598851 2006 Oral glucose ingestion attenuates exercise-induced activation of 5'-AMP-activated protein kinase in human skeletal muscle.
16567511 2006 A polymorphism in the AMPKalpha2 subunit gene is associated with insulin resistance and type 2 diabetes in the Japanese population.
16518831 2006 AMP-dependent protein kinase alpha 2 isoform promotes hypoxia-induced VEGF expression in human glioblastoma.
16505254 2006 Haplotype structures and large-scale association testing of the 5' AMP-activated protein kinase genes PRKAA2, PRKAB1, and PRKAB2 [corrected] with type 2 diabetes.
16483872 2006 ?2 isoform-specific activation of 5'adenosine monophosphate-activated protein kinase by 5-aminoimidazole-4-carboxamide-1-?-D-ribonucleoside at a physiological level activates glucose transport and increases glucose transporter 4 in mouse skeletal muscle.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16275868 2005 Increased alpha2 subunit-associated AMPK activity and PRKAG2 cardiomyopathy.
16054096 2005 Ca2+/calmodulin-dependent protein kinase kinase-beta acts upstream of AMP-activated protein kinase in mammalian cells.
16054095 2005 Calmodulin-dependent protein kinase kinase-beta is an alternative upstream kinase for AMP-activated protein kinase.
16054041 2005 AMP-activated protein kinase: ancient energy gauge provides clues to modern understanding of metabolism.
15980064 2005 The Ca2+/calmodulin-dependent protein kinase kinases are AMP-activated protein kinase kinases.
15866171 2005 AMP-activated protein kinase induces a p53-dependent metabolic checkpoint.
15640157 2005 Glucose deprivation increases mRNA stability of vascular endothelial growth factor through activation of AMP-activated protein kinase in DU145 prostate carcinoma.
15572372 2005 AMP-activated protein kinase mediates phenobarbital induction of CYP2B gene expression in hepatocytes and a newly derived human hepatoma cell line.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15371448 2004 AMP-activated protein kinase is required for the lipid-lowering effect of metformin in insulin-resistant human HepG2 cells.
15297373 2004 AMP-activated protein kinase activity is required for vanadate-induced hypoxia-inducible factor 1alpha expression in DU145 cells.
15231718 2004 Beta-adrenergic stimulation of skeletal muscle HSL can be overridden by AMPK signaling.
15060529 2004 AMP kinase and malonyl-CoA: targets for therapy of the metabolic syndrome.
15058305 2004 AMP-kinase regulates food intake by responding to hormonal and nutrient signals in the hypothalamus.
14985505 2004 The tumor suppressor LKB1 kinase directly activates AMP-activated kinase and regulates apoptosis in response to energy stress.
14985344 2004 Inhibition of inducible nitric-oxide synthase by activators of AMP-activated protein kinase: a new mechanism of action of insulin-sensitizing drugs.
14742438 2004 AMP-activated protein kinase plays a role in the control of food intake.
14729328 2004 The AMP-activated protein kinase cascade--a unifying system for energy control.
14709557 2004 Stimulation of the AMP-activated protein kinase leads to activation of eukaryotic elongation factor 2 kinase and to its phosphorylation at a novel site, serine 398.
14651849 2003 TSC2 mediates cellular energy response to control cell growth and survival.
14613924 2004 5'-AMP-activated protein kinase activity and protein expression are regulated by endurance training in human skeletal muscle.
12941758 2003 Effect of exercise intensity on skeletal muscle AMPK signaling in humans.
12847291 2003 Activation of yeast Snf1 and mammalian AMP-activated protein kinase by upstream kinases.
12788940 2003 AMP-activated protein kinase (AMPK) signaling in endothelial cells is essential for angiogenesis in response to hypoxic stress.
12663462 2003 Exercise increases nuclear AMPK alpha2 in human skeletal muscle.
12519745 2003 Physiological modulation of CFTR activity by AMP-activated protein kinase in polarized T84 cells.
12511592 2003 The AMP-activated protein kinase alpha2 catalytic subunit controls whole-body insulin sensitivity.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12456889 2002 Enhanced muscle fat oxidation and glucose transport by ACRP30 globular domain: acetyl-CoA carboxylase inhibition and AMP-activated protein kinase activation.
12444247 2002 AMP kinase is required for mitochondrial biogenesis in skeletal muscle in response to chronic energy deprivation.
12427743 2003 Regulation of channel gating by AMP-activated protein kinase modulates cystic fibrosis transmembrane conductance regulator activity in lung submucosal cells.
12413941 2002 Dissociation of AMPK activity and ACCbeta phosphorylation in human muscle during prolonged exercise.
12391032 2003 5'-AMP-activated protein kinase activity and subunit expression in exercise-trained human skeletal muscle.
12091379 2002 Hypoxia and nitric oxide treatment confer tolerance to glucose starvation in a 5'-AMP-activated protein kinase-dependent manner.
11797013 2002 Leptin stimulates fatty-acid oxidation by activating AMP-activated protein kinase.
11602624 2001 Role of AMP-activated protein kinase in mechanism of metformin action.
11554766 2001 Cell cycle regulation via p53 phosphorylation by a 5'-AMP activated protein kinase activator, 5-aminoimidazole- 4-carboxamide-1-beta-D-ribofuranoside, in a human hepatocellular carcinoma cell line.
11518699 2001 Regulation of transcription by AMP-activated protein kinase: phosphorylation of p300 blocks its interaction with nuclear receptors.
11389854 2001 A role for AMP-activated protein kinase in contraction- and hypoxia-regulated glucose transport in skeletal muscle.
11257506 2001 Molecular enzymology of carnitine transfer and transport.
10760274 2000 Role of AMP-activated protein kinase in the regulation by glucose of islet beta cell gene expression.
10698692 2000 Characterization of AMP-activated protein kinase gamma-subunit isoforms and their role in AMP binding.
10642499 2000 The regulation of AMP-activated protein kinase by phosphorylation.
9224708 1997 AMP-activated protein kinase isoenzyme family: subunit structure and chromosomal location.
9148944 1997 Contraction-induced changes in acetyl-CoA carboxylase and 5'-AMP-activated kinase in skeletal muscle.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7988703 1994 Molecular cloning, expression and chromosomal localisation of human AMP-activated protein kinase.
7959015 1994 Characterization and chromosomal localization of the human homologue of a rat AMP-activated protein kinase-encoding gene: a major regulator of lipid metabolism in mammals.
1536860 1992 Regulation of fatty acid and cholesterol metabolism by the AMP-activated protein kinase.
1365882 1992 AMP-activated protein kinase--an archetypal protein kinase cascade?