Property Summary

NCBI Gene PubMed Count 21
PubMed Score 29.88
PubTator Score 21.08

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Pathway (1)

Protein-protein Interaction (6)

Gene RIF (15)

PMID Text
26984527 findings establish that PolDIP2 can regulate the translesion synthesis polymerase and primer extension activities of PrimPol
26710848 Data suggest that, during genetic transcription, Prim-Pol-alpha-cat binds the DNA/RNA junction at 5prime-terminus of RNA primer (or initiating NTP, nucleoside-triphosphate).
26627254 Rad51 recombinase prevents Mre11 nuclease-dependent degradation and excessive PrimPol-mediated elongation of nascent DNA after UV irradiation
26626482 Implicate PrimPol in promoting restart of DNA synthesis downstream of, but closely coupled to, G4 replication impediments.
26552983 The molecular mechanism of polymerization and nucleoside reverse transcriptase inhibitor incorporation by human PrimPol have been described.
25746449 PrimPol tolerates DNA lesions, involving template and primer dislocations that can be operating during both mitochondrial and nuclear DNA replication. PrimPol could also operate as a translesion synthesis partner during DNA-directed RNA synthesis.
25550423 The authors propose a mechanism whereby single-stranded DNA binding proteins greatly restrict the contribution of PrimPol to DNA replication at stalled forks, thus reducing the mutagenic potential of PrimPol during genome replication.
25262353 The data establishes that a point mutation identified in PrimPol from patients with high myopia results in a major disruption of the catalytic and replication activities associated with human PrimPol thus establishing a link between replication stress and high myopia.
25255211 Data suggest that PrimPol exhibits fidelity that is 1.7-fold more accurate with magnesium as cofactor compared to manganese; activity of PrimPol is increased 400-1000-fold by manganese compared to magnesium based on steady-state kinetic parameters.
24682820 Although PrimPol's primase activity is required to restore wild-type replication fork rates in irradiated PrimPol-/- cells, the polymerase activity is sufficient to maintain regular replisome progression in unperturbed cells.
24267451 PrimPol is an important player in replication fork progression in eukaryotic cells.
24207056 Primpol is proposed to facilitate replication fork progression by acting as a translesion DNA polymerase or as a specific DNA primase reinitiating downstream of lesions that block synthesis during DNA replication.
24126761 PRIMPOL depletion results in increased spontaneous DNA damage and defects in the restart of stalled replication forks.
23579484 Identification of a novel missense variant of the CCDC111 gene in a high myopia family.
19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNRKWEAKLKQIEERASHYERKPLSSVYRPRLSKPEEPPSIWRLFHRQAQAFNFVKSCKEDVHVFALECK      1 - 70
VGDGQRIYLVTTYAEFWFYYKSRKNLLHCYEVIPENAVCKLYFDLEFNKPANPGADGKKMVALLIEYVCK     71 - 140
ALQELYGVNCSAEDVLNLDSSTDEKFSQHLIFQLHDVAFKDNIHVGNFLRKILQPALDLLGSEDDDSAPE    141 - 210
TTGHGFPHFSEAPARQGFSFNKMFTEKATEESWTSNSKKLERLGSAEQSSPDLSFLVVKNNMGEKHLFVD    211 - 280
LGVYTRNRNFRLYKSSKIGKRVALEVTEDNKFFPIQSKDVSDEYQYFLSSLVSNVRFSDTLRILTCEPSQ    281 - 350
NKQKGVGYFNSIGTSVETIEGFQCSPYPEVDHFVLSLVNKDGIKGGIRRWNYFFPEELLVYDICKYRWCE    351 - 420
NIGRAHKSNNIMILVDLKNEVWYQKCHDPVCKAENFKSDCFPLPAEVCLLFLFKEEEEFTTDEADETRSN    421 - 490
ETQNPHKPSPSRLSTGASADAVWDNGIDDAYFLEATEDAELAEAAENSLLSYNSEVDEIPDELIIEVLQE    491 - 560
//

Text Mined References (25)

PMID Year Title
26984527 2016 PolDIP2 interacts with human PrimPol and enhances its DNA polymerase activities.
26710848 2016 Insight into the Human DNA Primase Interaction with Template-Primer.
26627254 2015 Rad51 recombinase prevents Mre11 nuclease-dependent degradation and excessive PrimPol-mediated elongation of nascent DNA after UV irradiation.
26626482 2016 PrimPol Is Required for Replicative Tolerance of G Quadruplexes in Vertebrate Cells.
26552983 2015 Insights into the Molecular Mechanism of Polymerization and Nucleoside Reverse Transcriptase Inhibitor Incorporation by Human PrimPol.
25746449 2015 Alternative solutions and new scenarios for translesion DNA synthesis by human PrimPol.
25550423 2015 Human PrimPol is a highly error-prone polymerase regulated by single-stranded DNA binding proteins.
25262353 2014 Human PrimPol mutation associated with high myopia has a DNA replication defect.
25255211 2014 Kinetic analysis of human PrimPol DNA polymerase activity reveals a generally error-prone enzyme capable of accurately bypassing 7,8-dihydro-8-oxo-2'-deoxyguanosine.
24682820 2014 Molecular dissection of the domain architecture and catalytic activities of human PrimPol.
24267451 2013 PrimPol bypasses UV photoproducts during eukaryotic chromosomal DNA replication.
24240614 2013 Repriming of DNA synthesis at stalled replication forks by human PrimPol.
24207056 2013 PrimPol, an archaic primase/polymerase operating in human cells.
24126761 2013 hPrimpol1/CCDC111 is a human DNA primase-polymerase required for the maintenance of genome integrity.
23579484 2013 Exome sequencing reveals CCDC111 mutation associated with high myopia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16027112 2005 Origin and evolution of the archaeo-eukaryotic primase superfamily and related palm-domain proteins: structural insights and new members.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.