1. Home
  2. Targets
  3. DNA primase large subunit

Tbio DNA primase large subunit

DNA primase is the polymerase that synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.

This gene encodes the 58 kilodalton subunit of DNA primase, an enzyme that plays a key role in the replication of DNA. The encoded protein forms a heterodimer with a 49 kilodalton subunit. This heterodimer functions as a DNA-directed RNA polymerase to synthesize small RNA primers that are used to create Okazaki fragments on the lagging strand of the DNA. Alternative splicing of this gene results in multiple transcript variants. This gene has a related pseudogene, which is also present on chromosome 6. [provided by RefSeq, Apr 2014]

 Comments

Property Summary

NCBI Gene PubMed Count 27
PubMed Score 0.00
PubTator Score 18.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -1.400 9.6e-04
osteosarcoma 2.630 1.3e-02
glioblastoma 1.400 3.5e-03
sonic hedgehog group medulloblastoma 2.400 2.9e-07
atypical teratoid / rhabdoid tumor 1.500 4.3e-06
medulloblastoma, large-cell 2.400 6.1e-05
primitive neuroectodermal tumor 1.500 5.0e-05
non-small cell lung cancer 1.273 6.4e-16
lung cancer 1.500 2.1e-02
pediatric high grade glioma 1.300 1.3e-04
posterior fossa group A ependymoma 1.100 9.3e-05
lung adenocarcinoma 1.300 3.6e-05
Gaucher disease type 1 -1.100 3.9e-02

Synonym

Accession P49643 Q53FJ8 Q6P1Q7 Q8WVL2 Q9H413
Symbols p58
PRIM2A

Gene

PRIM2

PDB

3L9Q   3Q36   4BPU   4BPW   4BPX   4RR2   5DQO   5EXR   5F0Q   5F0S  

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 UniProt Keyword (17)

See all...

 GO Function (4)

 GO Component (2)

 GO Process (5)

 Compartment GO Term (1)

 GWAS Trait (1)

 HCA RNA Cell Line (56)

See all...

Pathway (31)

See all...

Protein-protein Interaction (10)

RPA2   RPA1   RPA3   RFC4   RFC2   RFC1   RFC3   RPA4   MCM10   MCM8  

Gene RIF (8)

PMID Text
26710848 Data suggest that PRIM1-p58,C-terminal domain stays bound to initiating NTP and 3prime-overhang DNA during whole cycle of RNA primer synthesis; meanwhile, PRIM1-p49 slides along DNA template toward 5prime-end with PRIM1-p58,N-terminal domain attached.
25550159 Data indicate that the conformational changes in primase are necessary to accomplish the initiation and then elongation of RNA synthesis.
24962573 the N-terminal domain of the large subunit of primase (p58N) directly interacts with the C-terminal domain of the catalytic subunit of polalpha (p180C)
22437878 PRIM2 gene is not imprinted in the placenta.
21346410 The fragment that forms a beta-sheet in the reported structure p58C/3L9Q of the same human primase domain is folded in three alpha-helices in our p58C/3Q36 structure, similarly to yeast primase.
20643958 p58C(C-terminal regulatory domain of the large subunit) structure reveals a novel arrangement of an evolutionarily conserved 4Fe-4S cluster buried deeply within the protein core and is not similar to any known protein structure.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17893144 analysis of the iron-sulfur cluster in the C-terminal domain of the p58 subunit of human DNA primase

AA Sequence 

MEFSGRKWRKLRLAGDQRNASYPHCLQFYLQPPSENISLIEFENLAIDRVKLLKSVENLGVSYVKGTEQY      1 - 70
QSKLESELRKLKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEELRRWFIQQEMDLLRFRFSILPKDKI     71 - 140
QDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFESIYKIPFADALDLFRGRKVYLEDGFAYVP    141 - 210
LKDIVAIILNEFRAKLSKALALTARSLPAVQSDERLQPLLNHLSHSYTGQDYSTQGNVGKISLDQIDLLS    211 - 280
TKSFPPCMRQLHKALRENHHLRHGGRMQYGLFLKGIGLTLEQALQFWKQEFIKGKMDPDKFDKGYSYNIR    281 - 350
HSFGKEGKRTDYTPFSCLKIILSNPPSQGDYHGCPFRHSDPELLKQKLQSYKISPGGISQILDLVKGTHY    351 - 420
QVACQKYFEMIHNVDDCGFSLNHPNQFFCESQRILNGGKDIKKEPIQPETPQPKPSVQKTKDASSALASL    421 - 490
NSSLEMDMEGLEDYFSEDS                                                       491 - 509
//

Text Mined References (33)

PMID Year Title
26710848 2016 Insight into the Human DNA Primase Interaction with Template-Primer.
25550159 2015 Crystal structure of the human primase.
24962573 2014 The C-terminal domain of the DNA polymerase catalytic subunit regulates the primase and polymerase activities of the human DNA polymerase ?-primase complex.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22437878 2012 Lack of genomic imprinting of DNA primase, polypeptide 2 (PRIM2) in human term placenta and white blood cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21346410 2011 Crystal structure of the C-terminal domain of human DNA primase large subunit: implications for the mechanism of the primase-polymerase ? switch.
21269460 2011 Initial characterization of the human central proteome.
20675616 2010 The genomic distribution and local context of coincident SNPs in human and chimpanzee.
20643958 2010 Insights into eukaryotic DNA priming from the structure and functional interactions of the 4Fe-4S cluster domain of human DNA primase.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19305001 2009 XRCC1 interacts with the p58 subunit of DNA Pol alpha-primase and may coordinate DNA repair and replication during S phase.
17893144 2007 An iron-sulfur cluster in the C-terminal domain of the p58 subunit of human DNA primase.
16307020 2006 Assessment of F-MuLV-induced tumorigenesis reveals new candidate tumor genes including Pecam1, St7, and Prim2.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12220650 2002 Control of complex formation of DNA polymerase alpha-primase and cell-free DNA replication by the C-terminal amino acids of the largest subunit p180.
11939784 2002 The p58 subunit of human DNA primase is important for primer initiation, elongation, and counting.
10504261 1999 Interactions of DNA with human DNA primase monitored with photoactivatable cross-linking agents: implications for the role of the p58 subunit.
10433721 1999 Human DNA primase: anion inhibition, manganese stimulation, and their effects on in vitro start-site selection.
9705292 1998 Primase activity of human DNA polymerase alpha-primase. Divalent cations stabilize the enzyme activity of the p48 subunit.
9563011 1997 Mapping specific protein-protein interactions within the core component of the breast cell DNA synthesome.
9116489 1997 Expression, purification, and characterization of the two human primase subunits and truncated complexes from Escherichia coli.
8530050 1995 Assignment of the 49-kDa (PRIM1) and 58-kDa (PRIM2A and PRIM2B) subunit genes of the human DNA primase to chromosome bands 1q44 and 6p11.1-p12.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
8026492 1994 DNA replication in vitro by recombinant DNA-polymerase-alpha-primase.
6693436 1984 DNA primase from KB cells. Characterization of a primase activity tightly associated with immunoaffinity-purified DNA polymerase-alpha.