Property Summary

NCBI Gene PubMed Count 16
PubMed Score 13.67
PubTator Score 5.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
osteosarcoma -1.447 2.2e-02
ependymoma -1.600 5.7e-07
glioblastoma -1.900 2.3e-03
medulloblastoma -1.900 1.4e-02
atypical teratoid / rhabdoid tumor -3.000 8.6e-07
medulloblastoma, large-cell -2.900 2.9e-03
primitive neuroectodermal tumor -1.800 1.6e-02
non-small cell lung carcinoma -1.300 6.6e-27
intraductal papillary-mucinous adenoma (... -1.600 1.3e-03
intraductal papillary-mucinous carcinoma... -1.700 2.7e-02
lung adenocarcinoma -1.500 5.0e-17
adult high grade glioma -1.500 4.3e-03
invasive ductal carcinoma -2.000 4.4e-04
ovarian cancer -1.900 4.2e-14
pituitary cancer 1.800 1.6e-05

Gene RIF (3)

PMID Text
23711981 2 autism-spectrum-disorder patients had distinct, paternally inherited, heterozygous, non-synonymous PRICKLE2 variants (p.E8Q and p.V153I) shared by their affected siblings. These variants had deficits in morphological and electrophysiological assays.
22037766 MINK1 interacts with and phosphorylates PRICKLE1 and PRICKLE2.
12525887 PRICKLE1 and PRICKLE2 mRNAs were expressed together in brain, eye and testis.

AA Sequence

MVTVMPLEMEKTISKLMFDFQRNSTSDDDSGCALEEYAWVPPGLKPEQVHQYYSCLPEEKVPYVNSPGEK      1 - 70
LRIKQLLHQLPPHDNEVRYCNSLDEEEKRELKLFSSQRKRENLGRGNVRPFPVTMTGAICEQCGGQINGG     71 - 140
DIAVFASRAGHGVCWHPPCFVCTVCNELLVDLIYFYQDGKIYCGRHHAECLKPRCAACDEIIFADECTEA    141 - 210
EGRHWHMKHFCCFECETVLGGQRYIMKEGRPYCCHCFESLYAEYCDTCAQHIGIDQGQMTYDGQHWHATE    211 - 280
TCFCCAHCKKSLLGRPFLPKQGQIFCSRACSAGEDPNGSDSSDSAFQNARAKESRRSAKIGKNKGKTEEP    281 - 350
MLNQHSQLQVSSNRLSADVDPLSLQMDMLSLSSQTPSLNRDPIWRSREEPYHYGNKMEQNQTQSPLQLLS    351 - 420
QCNIRTSYSPGGQGAGAQPEMWGKHFSNPKRSSSLAMTGHAGSFIKECREDYYPGRLRSQESYSDMSSQS    421 - 490
FSETRGSIQVPKYEEEEEEEGGLSTQQCRTRHPISSLKYTEDMTPTEQTPRGSMESLALSNATGLSADGG    491 - 560
AKRQEHLSRFSMPDLSKDSGMNVSEKLSNMGTLNSSMQFRSAESVRSLLSAQQYQEMEGNLHQLSNPIGY    561 - 630
RDLQSHGRMHQSFDFDGGMAGSKLPGQEGVRIQPMSERTRRRATSRDDNRRFRPHRSRRSRRSRSDNALH    631 - 700
LASEREAISRLKDRPPLRAREDYDQFMRQRSFQESMGHGSRRDLYGQCPRTVSDLALQNAFGDRWGPYFA    701 - 770
EYDWCSTCSSSSESDNEGYFLGEPIPQPARLRYVTSDELLHKYSSYGLPKSSTLGGRGQLHSRKRQKSKN    771 - 840
CIIS                                                                      841 - 844
//

Text Mined References (20)

PMID Year Title
26942292 2016 Response to Sandford et al.: PRICKLE2 Variants in Epilepsy: A Call for Precision Medicine.
26942291 2016 PRICKLE2 Mutations Might Not Be Involved in Epilepsy.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23711981 2013 Disruption of the non-canonical Wnt gene PRICKLE2 leads to autism-like behaviors with evidence for hippocampal synaptic dysfunction.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
22037766 2012 Mink1 regulates ?-catenin-independent Wnt signaling via Prickle phosphorylation.
21276947 2011 Mutations in prickle orthologs cause seizures in flies, mice, and humans.
19303062 2009 Genome-wide association study of vitamin B6, vitamin B12, folate, and homocysteine blood concentrations.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17411337 2007 Towards complete sets of farnesylated and geranylgeranylated proteins.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12525887 2003 Identification and characterization of human PRICKLE1 and PRICKLE2 genes as well as mouse Prickle1 and Prickle2 genes homologous to Drosophila tissue polarity gene prickle.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.