Property Summary

NCBI Gene PubMed Count 16
PubMed Score 15.47
PubTator Score 5.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.500 4.3e-03
atypical teratoid / rhabdoid tumor -3.000 8.6e-07
ependymoma -1.600 5.7e-07
glioblastoma -1.400 1.2e-04
group 4 medulloblastoma -1.700 1.3e-02
intraductal papillary-mucinous adenoma (... -1.600 1.3e-03
intraductal papillary-mucinous carcinoma... -1.700 2.7e-02
invasive ductal carcinoma -2.000 4.4e-04
lung adenocarcinoma -1.200 3.1e-14
medulloblastoma, large-cell -2.900 2.9e-03
non-small cell lung cancer -1.034 3.6e-13
osteosarcoma -1.447 2.2e-02
ovarian cancer -1.900 4.2e-14
pituitary cancer 1.800 1.6e-05
primitive neuroectodermal tumor -1.800 1.6e-02

Gene RIF (3)

AA Sequence

MVTVMPLEMEKTISKLMFDFQRNSTSDDDSGCALEEYAWVPPGLKPEQVHQYYSCLPEEKVPYVNSPGEK      1 - 70
LRIKQLLHQLPPHDNEVRYCNSLDEEEKRELKLFSSQRKRENLGRGNVRPFPVTMTGAICEQCGGQINGG     71 - 140
DIAVFASRAGHGVCWHPPCFVCTVCNELLVDLIYFYQDGKIYCGRHHAECLKPRCAACDEIIFADECTEA    141 - 210
EGRHWHMKHFCCFECETVLGGQRYIMKEGRPYCCHCFESLYAEYCDTCAQHIGIDQGQMTYDGQHWHATE    211 - 280
TCFCCAHCKKSLLGRPFLPKQGQIFCSRACSAGEDPNGSDSSDSAFQNARAKESRRSAKIGKNKGKTEEP    281 - 350
MLNQHSQLQVSSNRLSADVDPLSLQMDMLSLSSQTPSLNRDPIWRSREEPYHYGNKMEQNQTQSPLQLLS    351 - 420
QCNIRTSYSPGGQGAGAQPEMWGKHFSNPKRSSSLAMTGHAGSFIKECREDYYPGRLRSQESYSDMSSQS    421 - 490
FSETRGSIQVPKYEEEEEEEGGLSTQQCRTRHPISSLKYTEDMTPTEQTPRGSMESLALSNATGLSADGG    491 - 560
AKRQEHLSRFSMPDLSKDSGMNVSEKLSNMGTLNSSMQFRSAESVRSLLSAQQYQEMEGNLHQLSNPIGY    561 - 630
RDLQSHGRMHQSFDFDGGMAGSKLPGQEGVRIQPMSERTRRRATSRDDNRRFRPHRSRRSRRSRSDNALH    631 - 700
LASEREAISRLKDRPPLRAREDYDQFMRQRSFQESMGHGSRRDLYGQCPRTVSDLALQNAFGDRWGPYFA    701 - 770
EYDWCSTCSSSSESDNEGYFLGEPIPQPARLRYVTSDELLHKYSSYGLPKSSTLGGRGQLHSRKRQKSKN    771 - 840
CIIS                                                                      841 - 844
//

Text Mined References (20)

PMID Year Title