Property Summary

NCBI Gene PubMed Count 65
PubMed Score 13.16
PubTator Score 164.30

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (26)

PMID Text
25266917 free protein in nasal mucus can be used as a biomarker to diagnose chronic rhinosinusitis
24814827 mRNA levels of eosinophil granule proteins, rather than sputum eosinophil%, may reflect airway hyperresponsiveness and airflow limitation.
24112102 Eosinophil major basic protein activates human cord blood mast cells primed with fibroblast membranes by integrin-beta1.
23033876 During pregnancy, the proform of eosinophil major basic protein-angiotensinogen constitutes the major form in late pregnancy.
20977431 Combinations of respiratory syncytial virus and MBP synergistically induced cell death in pulmonary alveolar epithelial cells (A549).
20849415 novel transcript was alternatively transcribed from intron III of the ENO1 gene and was feasible for MBP-1 production
20237496 Observational study of gene-disease association. (HuGE Navigator)
19626619 The proMBP is a novel first trimester serum marker for adverse pregnancy outcome.
19398958 addition to granule-stored MBP, even unstimulated eosinophils contained appreciable amounts of MBP within secretory vesicles
19039208 The significantly elevated levels of proMBP in myelofibrosis patients implies that proMBP could be an important stromal cytokine in bone marrow fibrosis.
19014520 No variation in genes major basic protein for Atopic dermatitis pathogenesis in this German cohort
18852884 knockdown of endogenous MBP-1 is involved in cellular senescence of HFF through p53-p21 pathway.
18720885 The expression of MBP in nasal mucus obtained from chronic rhinosinusitispatients was obviously higher than that of nasal mucus obtained from controls.
18476621 MBP and NE collaborated to cause the pathological effects of nasal polyps.
17308074 HIV-Tat peptide interferes with polyamine uptake via competition for proteoglycan binding sites rather than a putative downstream transporter in human carcinoma cells
17223728 Pregnancy-associated plasma protein A is involved in processes preceding vulnerable plaque development in acute coronary syndrome.
17082653 Compared to MBP1, which is present in eosinophils, basophils, and a human mast cell line, homologous MBP2 is present only in eosinophils and may be a useful biomarker for eosinophil-associated diseases.
16940047 two regions shown previously to contain the cytotoxic and cytostimulatory properties of MBP are accessible for ligand interaction in cell surface-bound MBP
15647258 the proform of eosinophil major basic protein inhibits the proteolytic activity of PAPP-A
14988014 Proform of MPB forms a covalent complex with PAPPA in which PAPPA is inhibited.
14500673 MBP stimulates a Src kinase-dependent activation of class I(A) phosphoinositide 3-kinase and, in turn, activation of protein kinase C zeta in neutrophils, which contributes to the activation of NADPH oxidase and resultant superoxide production.
12534990 Deposits of eosinophilic MBP are found on the surface of eosinophils and damaged muscle fibers surrounded by eosinophils in patients with idiopathic eosinophilic myositis.
12421832 MBP's structure is described, and its ability to bind to pregnancy-associated plasma protein A explained
12370176 IGF bioactivity is regulated by reversible cell surface binding of PAPP-A, which in turn is regulated by proMBP
12202480 Transcription is regulated by novel combinatorial interactions of GATA-1, PU.1, and C/EBPepsilon isoforms.
319906 This protein contains a peptide that displays strong antibacterial activity against Gram-positive bacteria, Gram-negative bacteria, and fungi.

AA Sequence

MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEWGSGSEDASKK      1 - 70
DGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQAWFTCRRCYRGNLVSIHNFN     71 - 140
INYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRWNFAYWAAHQPWSRGGHCVALCTRGGHWRRA    141 - 210
HCLRRLPFICSY                                                              211 - 222
//

Text Mined References (69)

PMID Year Title
25266917 2015 An immunologic test for chronic rhinosinusitis based on free intranasal eosinophilic major basic protein.
24814827 2014 Expression levels of eosinophil granule protein mRNAs in induced sputum reflect airway hyperresponsiveness and airflow limitation.
24112102 2013 Eosinophil major basic protein activates human cord blood mast cells primed with fibroblast membranes by integrin-?1.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23033876 2013 Formation of high-molecular-weight angiotensinogen during pregnancy is a result of competing redox reactions with the proform of eosinophil major basic protein.
22412388 2012 A genome-wide scan of Ashkenazi Jewish Crohn's disease suggests novel susceptibility loci.
20977431 2011 Effects of respiratory syncytial virus infection and major basic protein derived from eosinophils in pulmonary alveolar epithelial cells (A549).
20849415 2010 MBP-1 is efficiently encoded by an alternative transcript of the ENO1 gene but post-translationally regulated by proteasome-dependent protein turnover.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19626619 2009 The proform of eosinophil major basic protein: a new maternal serum marker for adverse pregnancy outcome.
19398958 2009 Vesicle-mediated secretion of human eosinophil granule-derived major basic protein.
19039208 2008 Clinical correlates of serum pro-major basic protein in a spectrum of eosinophilic disorders and myelofibrosis.
19014520 2008 Variation in genes encoding eosinophil granule proteins in atopic dermatitis patients from Germany.
18852884 2008 Knockdown of MBP-1 in human foreskin fibroblasts induces p53-p21 dependent senescence.
18720885 2008 [Expression and its significance of eosinophil major basic protein in chronic rhinosinusitis].
18694936 2008 Post-translational tyrosine nitration of eosinophil granule toxins mediated by eosinophil peroxidase.
18476621 2008 [Expression of eosinophil major basic protein and neutrophil elastase in nasal polyp tissue and secretion].
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17223728 2008 Pregnancy-associated plasma protein A and proform eosinophilic major basic protein in the detection of different types of coronary artery disease.
17136616 2007 Human eosinophil major basic protein 2: location of disulfide bonds and free sulfhydryl groups.
17082653 2006 Major basic protein homolog (MBP2): a specific human eosinophil marker.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16940047 2006 The proform of the eosinophil major basic protein binds the cell surface through a site distinct from its C-type lectin ligand-binding region.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15647258 2005 Proteinase inhibition by proform of eosinophil major basic protein (pro-MBP) is a multistep process of intra- and intermolecular disulfide rearrangements.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14988014 2004 Inhibition of proteolysis by the proform of eosinophil major basic protein (proMBP) requires covalent binding to its target proteinase.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14500673 2003 Eosinophil major basic protein stimulates neutrophil superoxide production by a class IA phosphoinositide 3-kinase and protein kinase C-zeta-dependent pathway.
12534990 2003 Eosinophilic major basic protein and interleukin-5 in eosinophilic myositis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421832 2003 Complex of pregnancy-associated plasma protein-A and the proform of eosinophil major basic protein. Disulfide structure and carbohydrate attachment.
12393403 2003 Non-IgE-dependent activation of human lung- and cord blood-derived mast cells is induced by eosinophil major basic protein and modulated by the membrane form of stem cell factor.
12370176 2002 Cell surface targeting of pregnancy-associated plasma protein A proteolytic activity. Reversible adhesion is mediated by two neighboring short consensus repeats.
12202480 2002 Novel combinatorial interactions of GATA-1, PU.1, and C/EBPepsilon isoforms regulate transcription of the gene encoding eosinophil granule major basic protein.
12176337 2002 Identification of a plasma membrane Raft-associated PKB Ser473 kinase activity that is distinct from ILK and PDK1.
12149249 2002 Direct identification of tyrosine 474 as a regulatory phosphorylation site for the Akt protein kinase.
11546794 2001 Heregulin-dependent activation of phosphoinositide 3-kinase and Akt via the ErbB2/ErbB3 co-receptor.
11445557 2001 Regulation of Akt/PKB activation by tyrosine phosphorylation.
11319227 2001 Crystal structure of the eosinophil major basic protein at 1.8 A. An atypical lectin with a paradigm shift in specificity.
11278835 2001 Inhibition of insulin-induced activation of Akt by a kinase-deficient mutant of the epsilon isozyme of protein kinase C.
11222751 2001 Sp1 phosphorylation regulates inducible expression of platelet-derived growth factor B-chain gene via atypical protein kinase C-zeta.
11170744 2001 Comparative structure, proximal promoter elements, and chromosome location of the human eosinophil major basic protein genes.
10913121 2000 Expression of recombinant human pregnancy-associated plasma protein-A and identification of the proform of eosinophil major basic protein as its physiological inhibitor.
10698680 2000 The PI3K-PDK1 connection: more than just a road to PKB.
10491647 1999 Messenger ribonucleic acid levels of pregnancy-associated plasma protein-A and the proform of eosinophil major basic protein: expression in human reproductive and nonreproductive tissues.
10357815 1999 Serum and glucocorticoid-inducible kinase (SGK) is a target of the PI 3-kinase-stimulated signaling pathway.
9748166 1998 Protein kinase C isotypes controlled by phosphoinositide 3-kinase through the protein kinase PDK1.
9736715 1998 Phosphoinositide-3-OH kinase-dependent regulation of glycogen synthase kinase 3 and protein kinase B/AKT by the integrin-linked kinase.
8547309 1995 Cloning of cDNA for rat eosinophil major basic protein.
8507662 1993 Pro-major basic protein has three types of sugar chains at the pro-portion.
8137941 1994 Localization of disulfide bridges and free sulfhydryl groups in human eosinophil granule major basic protein.
7727786 1995 Association of granulocyte-macrophage colony-stimulating factor with the crystalloid granules of human eosinophils.
7685339 1993 Circulating human pregnancy-associated plasma protein-A is disulfide-bridged to the proform of eosinophil major basic protein.
7539791 1995 Identification of angiotensinogen and complement C3dg as novel proteins binding the proform of eosinophil major basic protein in human pregnancy serum and plasma.
7531438 1995 Human eosinophil major basic protein, a mediator of allergic inflammation, is expressed by alternative splicing from two promoters.
7526035 1994 Localization of pregnancy-associated plasma protein-A and colocalization of pregnancy-associated plasma protein-A messenger ribonucleic acid and eosinophil granule major basic protein messenger ribonucleic acid in placenta.
7524900 1994 Location and nature of carbohydrate groups in proform of human major basic protein isolated from pregnancy serum.
7508748 1994 Amino acid sequence of human pregnancy-associated plasma protein-A derived from cloned cDNA.
3422083 1988 Eosinophil granule cationic proteins: major basic protein is distinct from the smaller subunit of eosinophil peroxidase.
3410852 1988 Biochemical and amino acid sequence analysis of human eosinophil granule major basic protein.
3199069 1988 Isolation of a complementary DNA clone encoding a precursor to human eosinophil major basic protein.
3171483 1988 Acidic precursor revealed in human eosinophil granule major basic protein cDNA.
2584934 1989 Evidence of eosinophil granule major basic protein in human placenta.
2501794 1989 Antibiotic proteins of human polymorphonuclear leukocytes.
2323577 1990 Cloning and sequence analysis of the human gene encoding eosinophil major basic protein.
1565101 1992 Purification and cDNA cloning of a novel factor produced by a human T-cell hybridoma: sequence homology with animal lectins.
319906 1977 Localization of somatostatin-like immunoreactivity in the pancreatic islets of the hagfish, Myxine glutinosa and the lamprey Lampetra fluviatilis.