Property Summary

NCBI Gene PubMed Count 20
PubMed Score 15.17
PubTator Score 20.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (16)

PMID Text
26884185 findings identify PREX2 as a mediator of NRAS-mutant melanoma development that acts through the PI3K/PTEN/Akt pathway to regulate gene expression of a cell cycle regulator
26718453 The results of the present study suggested that PREX2a may act as an oncogene in osteosarcoma via the inhibition of PTEN activity and activation of PI3K signaling.
26438819 second messengers activate the Rac1 signal, which sets in motion a cascade whereby PAKs phosphorylate and negatively regulate PREX2 to decrease Rac1 activation.
25829446 PREX2 mutants are likely selected in cancer to escape PTEN-mediated inhibition of invasion.
25151370 CXCL9 is involved in the invasion ability of hepatocellular carcinoma cells possibly through up-regulation of its potential effector PREX2.
24375644 Results demonstrate that miR-338-3p affects gastric cancer progression through PTEN-AKT signaling by targeting P-Rex2a in gastric cancer cells
24367090 P-REX2 PH-domain-mediated inhibition of PTEN has a role in regulating insulin sensitivity and glucose homeostasis
24140344 MiR-338-3p affects the PTEN/Akt pathway by down-regulating PREX2a.
23033535 Studies indicate relevance of P-Rex1 and P-Rex2a, in breast tumorigenesis, and suggest that the exchange factors Vav2 and Vav3 play synergistic roles in breast cancer by sustaining tumor growth, neoangiogenesis, and metastasis.
22622578 Analysis of whole-genome sequence data identified PREX2 (phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 2)--a PTEN-interacting protein and negative regulator of PTEN in breast cancer--as a significantly mutated gene with a mutation frequency of approximately 14% in an independent extension cohort of 107 human melanomas
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19861688 suggests that aberrant control of PTEN by P-REX2a may represent a key tumorigenic mechanism, in agreement with recent studies supporting the pathological relevance of several other proposed PTEN regulators
19729658 identified P-REX2a as a PTEN-interacting protein; P-REX2a inhibited PTEN lipid phosphatase activity & stimulated the PI3K pathway only in the presence of PTEN; P-REX2a is a component of the PI3K pathway that can antagonize PTEN in cancer cells
15897194 the pleckstrin homology domain of the Dbl family guanine nucleotide exchange factor P-Rex2 has a role in substrate specificity and recognition
15304343 P-Rex2 is a 183 kDa protein that activates the small GTPase Rac and is regulated by phosphatidylinositol (3,4,5)-trisphosphate.
15304342 P-REX2 may serve as a novel link between Rac activation and the PI-3 kinase pathway.

AA Sequence

MSEDSRGDSRAESAKDLEKQLRLRVCVLSELQKTERDYVGTLEFLVSAFLHRMNQCAASKVDKNVTEETV      1 - 70
KMLFSNIEDILAVHKEFLKVVEECLHPEPNAQQEVGTCFLHFKDKFRIYDEYCSNHEKAQKLLLELNKIR     71 - 140
TIRTFLLNCMLLGGRKNTDVPLEGYLVTPIQRICKYPLILKELLKRTPRKHSDYAAVMEALQAMKAVCSN    141 - 210
INEAKRQMEKLEVLEEWQSHIEGWEGSNITDTCTEMLMCGVLLKISSGNIQERVFFLFDNLLVYCKRKHR    211 - 280
RLKNSKASTDGHRYLFRGRINTEVMEVENVDDGTADFHSSGHIVVNGWKIHNTAKNKWFVCMAKTPEEKH    281 - 350
EWFEAILKERERRKGLKLGMEQDTWVMISEQGEKLYKMMCRQGNLIKDRKRKLTTFPKCFLGSEFVSWLL    351 - 420
EIGEIHRPEEGVHLGQALLENGIIHHVTDKHQFKPEQMLYRFRYDDGTFYPRNEMQDVISKGVRLYCRLH    421 - 490
SLFTPVIRDKDYHLRTYKSVVMANKLIDWLIAQGDCRTREEAMIFGVGLCDNGFMHHVLEKSEFKDEPLL    491 - 560
FRFFSDEEMEGSNMKHRLMKHDLKVVENVIAKSLLIKSNEGSYGFGLEDKNKVPIIKLVEKGSNAEMAGM    561 - 630
EVGKKIFAINGDLVFMRPFNEVDCFLKSCLNSRKPLRVLVSTKPRETVKIPDSADGLGFQIRGFGPSVVH    631 - 700
AVGRGTVAAAAGLHPGQCIIKVNGINVSKETHASVIAHVTACRKYRRPTKQDSIQWVYNSIESAQEDLQK    701 - 770
SHSKPPGDEAGDAFDCKVEEVIDKFNTMAIIDGKKEHVSLTVDNVHLEYGVVYEYDSTAGIKCNVVEKMI    771 - 840
EPKGFFSLTAKILEALAKSDEHFVQNCTSLNSLNEVIPTDLQSKFSALCSERIEHLCQRISSYKKFSRVL    841 - 910
KNRAWPTFKQAKSKISPLHSSDFCPTNCHVNVMEVSYPKTSTSLGSAFGVQLDSRKHNSHDKENKSSEQG    911 - 980
KLSPMVYIQHTITTMAAPSGLSLGQQDGHGLRYLLKEEDLETQDIYQKLLGKLQTALKEVEMCVCQIDDL    981 - 1050
LSSITYSPKLERKTSEGIIPTDSDNEKGERNSKRVCFNVAGDEQEDSGHDTISNRDSYSDCNSNRNSIAS   1051 - 1120
FTSICSSQCSSYFHSDEMDSGDELPLSVRISHDKQDKIHSCLEHLFSQVDSITNLLKGQAVVRAFDQTKY   1121 - 1190
LTPGRGLQEFQQEMEPKLSCPKRLRLHIKQDPWNLPSSVRTLAQNIRKFVEEVKCRLLLALLEYSDSETQ   1191 - 1260
LRRDMVFCQTLVATVCAFSEQLMAALNQMFDNSKENEMETWEASRRWLDQIANAGVLFHFQSLLSPNLTD   1261 - 1330
EQAMLEDTLVALFDLEKVSFYFKPSEEEPLVANVPLTYQAEGSRQALKVYFYIDSYHFEQLPQRLKNGGG   1331 - 1400
FKIHPVLFAQALESMEGYYYRDNVSVEEFQAQINAASLEKVKQYNQKLRAFYLDKSNSPPNSTSKAAYVD   1401 - 1470
KLMRPLNALDELYRLVASFIRSKRTAACANTACSASGVGLLSVSSELCNRLGACHIIMCSSGVHRCTLSV   1471 - 1540
TLEQAIILARSHGLPPRYIMQATDVMRKQGARVQNTAKNLGVRDRTPQSAPRLYKLCEPPPPAGEE       1541 - 1606
//

Text Mined References (22)

PMID Year Title
26884185 2016 Truncating PREX2 mutations activate its GEF activity and alter gene expression regulation in NRAS-mutant melanoma.
26718453 2016 Knockdown of PREX2a inhibits the malignant phenotype of osteosarcoma cells.
26438819 2015 p21-activated Kinases (PAKs) Mediate the Phosphorylation of PREX2 Protein to Initiate Feedback Inhibition of Rac1 GTPase.
25829446 2015 PTEN inhibits PREX2-catalyzed activation of RAC1 to restrain tumor cell invasion.
25151370 2014 The effect of CXCL9 on the invasion ability of hepatocellular carcinoma through up-regulation of PREX2.
24375644 2014 miR-338-3p suppresses gastric cancer progression through a PTEN-AKT axis by targeting P-REX2a.
24367090 2014 Regulation of PTEN inhibition by the pleckstrin homology domain of P-REX2 during insulin signaling and glucose homeostasis.
24140344 2013 miR-338-3p suppresses neuroblastoma proliferation, invasion and migration through targeting PREX2a.
23033535 2012 Rho GEFs and cancer: linking gene expression and metastatic dissemination.
22622578 2012 Melanoma genome sequencing reveals frequent PREX2 mutations.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19861688 2009 P-REX2a driving tumorigenesis by PTEN inhibition.
19729658 2009 Activation of the PI3K pathway in cancer through inhibition of PTEN by exchange factor P-REX2a.
17565979 2007 P-Rex1 links mammalian target of rapamycin signaling to Rac activation and cell migration.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15897194 2005 Substrate specificity and recognition is conferred by the pleckstrin homology domain of the Dbl family guanine nucleotide exchange factor P-Rex2.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15304343 2004 P-Rex2, a new guanine-nucleotide exchange factor for Rac.
15304342 2004 P-REX2, a novel PI-3-kinase sensitive Rac exchange factor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.