Property Summary

NCBI Gene PubMed Count 47
PubMed Score 41.99
PubTator Score 38.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
osteosarcoma -1.009 2.8e-02
atypical teratoid/rhabdoid tumor -1.400 1.3e-04
medulloblastoma, large-cell -1.500 1.2e-03
non-small cell lung cancer -1.323 7.4e-20
intraductal papillary-mucinous carcinoma... -1.100 9.7e-04
breast carcinoma 1.200 3.9e-03
fibroadenoma 1.100 1.3e-02
interstitial cystitis 1.600 3.6e-03
group 4 medulloblastoma -1.300 1.1e-02
subependymal giant cell astrocytoma -1.209 4.7e-02
lung adenocarcinoma -1.700 6.2e-10
invasive ductal carcinoma 1.010 2.5e-05
lung carcinoma -2.000 4.6e-20
ulcerative colitis 1.700 5.0e-05
ovarian cancer 1.500 2.5e-04
Breast cancer -1.200 1.4e-02

Gene RIF (32)

PMID Text
26797121 P-Rex1 contributes to the spatiotemporal localization of type I PKA, which tightly regulates this guanine exchange factor by a multistep mechanism.
26621702 findings suggest a vital role of P-Rex1 signaling in CA1 LTD that is critical for social behavior and cognitive function and offer new insight into the etiology of ASDs
26112412 The P-Rex1-Rac1 interface is critical for Rac1 activation in breast cancer cells.
25284585 P-REX1 promotes both PI3K/AKT and MEK/ERK signaling in breast cancer.
25248717 PREX1 gene promoter hypomethylation is a prognostic marker of poor patient survival.
23899556 Phosphorylation of P-Rex1 at serine 1169 participates in IGF-1R signaling in breast cancer cells.
23478800 Cucurbitacin I also failed to affect the activation of P-Rex1 by heregulin.
23382862 These data suggest that P-Rex1 has an influence on physiological migratory processes, such as invasion of cancer cells, both through effects upon classical Rac1-driven motility and a novel association with RTK signalling complexes.
23033535 Studies indicate relevance of P-Rex1 and P-Rex2a, in breast tumorigenesis, and suggest that the exchange factors Vav2 and Vav3 play synergistic roles in breast cancer by sustaining tumor growth, neoangiogenesis, and metastasis.
22242915 We have identified a novel mechanism for direct activation of P-Rex1 through PP1alpha-dependent dephosphorylation.
22207728 Demonstrate presence of P-Rex1 in platelets as well as its role in platelet secretion and aggregation induced by low-dose agonists for g-protein coupled receptors and by collagen.
21636851 HDACs could regulate P-Rex1 gene transcription by interaction with Sp1 and by region-specific changes in histone acetylation within the P-Rex1 promoter
21339740 Selective activation of Akt1 through mTORC2 and P-Rex1 regulates cancer cell migration, invasion and metastasis.
21172654 The P-Rex1 is highly overexpressed in human breast cancers and their derived cell lines, particularly those with high ErbB2 and ER expression.
21042280 study reports the identification of P-Rex1, as a novel mediator in signalling by ErbB/HER receptors; correlation between high P-Rex1 expression and poor patient outcome in breast cancer was found
20650312 SNPs near PREX1 may contribute to T2 Diabetes susceptibility mediated through effects of adiposity in European Americans.
20650312 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20074642 P-Rex1 is a critical component for formyl peptide receptor 1-mediated signaling leading to NADPH oxidase activation.
20036214 S1P(1) signaling linked to cell migration is facilitated by a functional interaction with P-Rex1 via a mechanism that involves the maintenance of S1P(1) receptors at the cell membrane.
20018810 P-Rex1 is a key element in stromal cell-derived factor-1-induced angiogenic responses and signaling pathway.
19911011 Observational study of gene-disease association. (HuGE Navigator)
19305425 P-Rex1-dependent activation of Rac promotes prostate cancer metastasis.
18697831 This study has identified P-Rex1 as a Rac3-guanine nucleotide exchange factor in neuronal cells that localises to, and regulates, actin cytoskeletal dynamics at the axonal growth cone to in turn regulate neurite differentiation.
18602983 Observational study of gene-disease association. (HuGE Navigator)
17698854 P-Rex1 membrane transport is mediated by G protein betagamma subunits and phosphoinositide 3-kinase
17565979 P-Rex1 links mTOR signaling to Rac activation and cell migration
17227822 Endogenous P-Rex1 translocates to areas of Rac2 and cytoskeletal activation at the leading edge in response to chemoattractant stimuli in human neutrophils and that this translocation can be negatively modulated by activation of PKA and by cell adhesion.
16301320 protein kinase A phosphorylates P-Rex1 andd inhibits the phosphatidylinositiol (3,4,5)-trisphosphate and Gbetagamma-mediated regulation of its activity
15545267 P-Rex1 is regulated by phosphatidylinositol (3,4,5)-trisphosphate and Gbetagamma subunits
12123595 P-Rex1 is synergistically activated by PIP(3) and Gbetagamma and may act as a coincidence detector for these signaling molecules
11955434 P-Rex1 appears to be a coincidence detector in PtdIns(3,4,5)P3 and Gbetagamma signaling pathways that is particularly adapted to function downstream of heterotrimeric G proteins in neutrophils.

AA Sequence

MEAPSGSEPGGDGAGDCAHPDPRAPGAAAPSSGPGPCAAARESERQLRLRLCVLNEILGTERDYVGTLRF      1 - 70
LQSAFLHRIRQNVADSVEKGLTEENVKVLFSNIEDILEVHKDFLAALEYCLHPEPQSQHELGNVFLKFKD     71 - 140
KFCVYEEYCSNHEKALRLLVELNKIPTVRAFLLSCMLLGGRKTTDIPLEGYLLSPIQRICKYPLLLKELA    141 - 210
KRTPGKHPDHPAVQSALQAMKTVCSNINETKRQMEKLEALEQLQSHIEGWEGSNLTDICTQLLLQGTLLK    211 - 280
ISAGNIQERAFFLFDNLLVYCKRKSRVTGSKKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHS    281 - 350
NGYTVTNGWKIHNTAKNKWFVCMAKTAEEKQKWLDAIIREREQRESLKLGMERDAYVMIAEKGEKLYHMM    351 - 420
MNKKVNLIKDRRRKLSTVPKCFLGNEFVAWLLEIGEISKTEEGVNLGQALLENGIIHHVSDKHQFKNEQV    421 - 490
MYRFRYDDGTYKARSELEDIMSKGVRLYCRLHSLYTPVIKDRDYHLKTYKSVLPGSKLVDWLLAQGDCQT    491 - 560
REEAVALGVGLCNNGFMHHVLEKSEFRDESQYFRFHADEEMEGTSSKNKQLRNDFKLVENILAKRLLILP    561 - 630
QEEDYGFDIEEKNKAVVVKSVQRGSLAEVAGLQVGRKIYSINEDLVFLRPFSEVESILNQSFCSRRPLRL    631 - 700
LVATKAKEIIKIPDQPDTLCFQIRGAAPPYVYAVGRGSEAMAAGLCAGQCILKVNGSNVMNDGAPEVLEH    701 - 770
FQAFRSRREEALGLYQWIYHTHEDAQEARASQEASTEDPSGEQAQEEDQADSAFPLLSLGPRLSLCEDSP    771 - 840
MVTLTVDNVHLEHGVVYEYVSTAGVRCHVLEKIVEPRGCFGLTAKILEAFAANDSVFVENCRRLMALSSA    841 - 910
IVTMPHFEFRNICDTKLESIGQRIACYQEFAAQLKSRVSPPFKQAPLEPHPLCGLDFCPTNCHINLMEVS    911 - 980
YPKTTPSVGRSFSIRFGRKPSLIGLDPEQGHLNPMSYTQHCITTMAAPSWKCLPAAEGDPQGQGLHDGSF    981 - 1050
GPASGTLGQEDRGLSFLLKQEDREIQDAYLQLFTKLDVALKEMKQYVTQINRLLSTITEPTSGGSCDASL   1051 - 1120
AEEASSLPLVSEESEMDRSDHGGIKKVCFKVAEEDQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNS   1121 - 1190
SYLGSDEMGSGDELPCDMRIPSDKQDKLHGCLEHLFNQVDSINALLKGPVMSRAFEETKHFPMNHSLQEF   1191 - 1260
KQKEECTIRGRSLIQISIQEDPWNLPNSIKTLVDNIQRYVEDGKNQLLLALLKCTDTELQLRRDAIFCQA   1261 - 1330
LVAAVCTFSKQLLAALGYRYNNNGEYEESSRDASRKWLEQVAATGVLLHCQSLLSPATVKEERTMLEDIW   1331 - 1400
VTLSELDNVTFSFKQLDENYVANTNVFYHIEGSRQALKVIFYLDSYHFSKLPSRLEGGASLRLHTALFTK   1401 - 1470
VLENVEGLPSPGSQAAEDLQQDINAQSLEKVQQYYRKLRAFYLERSNLPTDASTTAVKIDQLIRPINALD   1471 - 1540
ELCRLMKSFVHPKPGAAGSVGAGLIPISSELCYRLGACQMVMCGTGMQRSTLSVSLEQAAILARSHGLLP   1541 - 1610
KCIMQATDIMRKQGPRVEILAKNLRVKDQMPQGAPRLYRLCQPPVDGDL                        1611 - 1659
//

Text Mined References (50)

PMID Year Title
26797121 2016 Protein Kinase A (PKA) Type I Interacts with P-Rex1, a Rac Guanine Nucleotide Exchange Factor: EFFECT ON PKA LOCALIZATION AND P-Rex1 SIGNALING.
26621702 2015 Synaptic P-Rex1 signaling regulates hippocampal long-term depression and autism-like social behavior.
26112412 2015 The Phosphatidylinositol (3,4,5)-Trisphosphate-dependent Rac Exchanger 1·Ras-related C3 Botulinum Toxin Substrate 1 (P-Rex1·Rac1) Complex Reveals the Basis of Rac1 Activation in Breast Cancer Cells.
25284585 2015 P-REX1 creates a positive feedback loop to activate growth factor receptor, PI3K/AKT and MEK/ERK signaling in breast cancer.
25248717 2014 Subtype-specific overexpression of the Rac-GEF P-REX1 in breast cancer is associated with promoter hypomethylation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23899556 2013 Phosphorylation of P-Rex1 at serine 1169 participates in IGF-1R signaling in breast cancer cells.
23496005 2013 Clinical, polysomnographic and genome-wide association analyses of narcolepsy with cataplexy: a European Narcolepsy Network study.
23478800 2013 Cucurbitacin I inhibits Rac1 activation in breast cancer cells by a reactive oxygen species-mediated mechanism and independently of Janus tyrosine kinase 2 and P-Rex1.
23382862 2013 P-Rex1 cooperates with PDGFR? to drive cellular migration in 3D microenvironments.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23033535 2012 Rho GEFs and cancer: linking gene expression and metastatic dissemination.
22242915 2012 The guanine-nucleotide-exchange factor P-Rex1 is activated by protein phosphatase 1?.
22207728 2012 Role for the guanine nucleotide exchange factor phosphatidylinositol-3,4,5-trisphosphate-dependent rac exchanger 1 in platelet secretion and aggregation.
21636851 2011 Epigenetic regulation of phosphatidylinositol 3,4,5-triphosphate-dependent Rac exchanger 1 gene expression in prostate cancer cells.
21441931 2011 Common variation in GPC5 is associated with acquired nephrotic syndrome.
21339740 2011 Selective activation of Akt1 by mammalian target of rapamycin complex 2 regulates cancer cell migration, invasion, and metastasis.
21172654 2010 Identification of the Rac-GEF P-Rex1 as an essential mediator of ErbB signaling in breast cancer.
21042280 2011 P-Rex1 participates in Neuregulin-ErbB signal transduction and its expression correlates with patient outcome in breast cancer.
20650312 2010 Analysis of candidate genes on chromosome 20q12-13.1 reveals evidence for BMI mediated association of PREX1 with type 2 diabetes in European Americans.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20074642 2010 Characterization of P-Rex1 for its role in fMet-Leu-Phe-induced superoxide production in reconstituted COS(phox) cells.
20036214 2010 Sphingosine-1-phosphate receptor S1P1 is regulated by direct interactions with P-Rex1, a Rac guanine nucleotide exchange factor.
20018810 2010 Phosphatidylinositol 3,4,5-triphosphate-dependent Rac exchanger 1 (P-Rex-1), a guanine nucleotide exchange factor for Rac, mediates angiogenic responses to stromal cell-derived factor-1/chemokine stromal cell derived factor-1 (SDF-1/CXCL-12) linked to Rac activation, endothelial cell migration, and in vitro angiogenesis.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
19305425 2009 Upregulation of PIP3-dependent Rac exchanger 1 (P-Rex1) promotes prostate cancer metastasis.
18697831 2008 P-Rex1 - a multidomain protein that regulates neurite differentiation.
18602983 2008 Heterogeneity in gene loci associated with type 2 diabetes on human chromosome 20q13.1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17903302 2007 Framingham Heart Study 100K Project: genome-wide associations for blood pressure and arterial stiffness.
17698854 2007 Membrane translocation of P-Rex1 is mediated by G protein betagamma subunits and phosphoinositide 3-kinase.
17565979 2007 P-Rex1 links mammalian target of rapamycin signaling to Rac activation and cell migration.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17227822 2007 Signaling requirements for translocation of P-Rex1, a key Rac2 exchange factor involved in chemoattractant-stimulated human neutrophil function.
16301320 2006 Phosphorylation of P-Rex1 by the cyclic AMP-dependent protein kinase inhibits the phosphatidylinositiol (3,4,5)-trisphosphate and Gbetagamma-mediated regulation of its activity.
15545267 2005 Regulation of P-Rex1 by phosphatidylinositol (3,4,5)-trisphosphate and Gbetagamma subunits.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376548 2002 NRAGE, a p75 neurotrophin receptor-interacting protein, induces caspase activation and cell death through a JNK-dependent mitochondrial pathway.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
12123595 2002 Rac activation: P-Rex1 - a convergence point for PIP(3) and Gbetagamma?
11955434 2002 P-Rex1, a PtdIns(3,4,5)P3- and Gbetagamma-regulated guanine-nucleotide exchange factor for Rac.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11756498 2002 Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.
11549316 2001 A high-resolution 6.0-megabase transcript map of the type 2 diabetes susceptibility region on human chromosome 20.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.