Property Summary

Ligand Count 1
NCBI Gene PubMed Count 16
PubMed Score 29.95
PubTator Score 17.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Congenital myasthenic syndrome 25 3.053 1.5

Expression

  Differential Expression (32)

Disease log2 FC p
acute quadriplegic myopathy 1.889 6.0e-07
adult high grade glioma -1.300 1.4e-04
Alzheimer's disease -1.200 4.2e-02
Amyotrophic lateral sclerosis 1.373 6.9e-06
astrocytic glioma -1.200 3.5e-02
Astrocytoma, Pilocytic -1.200 7.3e-04
atypical teratoid / rhabdoid tumor -1.700 8.6e-07
autosomal dominant Emery-Dreifuss muscul... 1.364 2.3e-03
breast carcinoma 1.200 2.0e-02
dermatomyositis 1.200 2.2e-02
Duchenne muscular dystrophy 1.701 1.8e-09
ependymoma -1.300 2.2e-06
gastric cancer 1.200 2.9e-03
glioblastoma -1.100 8.8e-04
group 3 medulloblastoma -1.400 2.7e-02
hepatocellular carcinoma 1.100 6.9e-06
hereditary spastic paraplegia -1.082 5.5e-03
juvenile dermatomyositis 1.890 3.4e-12
limb girdle muscular dystrophy 2A 1.010 8.5e-05
lung adenocarcinoma 1.230 1.2e-07
lung cancer 1.400 9.3e-03
lung carcinoma 1.600 6.4e-27
medulloblastoma, large-cell -1.500 2.8e-05
non primary Sjogren syndrome sicca -1.500 1.8e-02
oligodendroglioma -1.300 4.9e-02
osteosarcoma 1.962 2.9e-04
ovarian cancer -1.700 5.1e-05
Parkinson's disease -1.600 8.7e-03
Pick disease -1.100 2.1e-02
primitive neuroectodermal tumor -1.300 3.3e-03
subependymal giant cell astrocytoma -1.641 3.3e-02
tuberculosis and treatment for 6 months -1.300 1.1e-04

Gene RIF (8)

AA Sequence

MQQKTKLFLQALKYSIPHLGKCMQKQHLNHYNFADHCYNRIKLKKYHLTKCLQNKPKISELARNIPSRSF      1 - 70
SCKDLQPVKQENEKPLPENMDAFEKVRTKLETQPQEEYEIINVEVKHGGFVYYQEGCCLVRSKDEEADND     71 - 140
NYEVLFNLEELKLDQPFIDCIRVAPDEKYVAAKIRTEDSEASTCVIIKLSDQPVMEASFPNVSSFEWVKD    141 - 210
EEDEDVLFYTFQRNLRCHDVYRATFGDNKRNERFYTEKDPSYFVFLYLTKDSRFLTINIMNKTTSEVWLI    211 - 280
DGLSPWDPPVLIQKRIHGVLYYVEHRDDELYILTNVGEPTEFKLMRTAADTPAIMNWDLFFTMKRNTKVI    281 - 350
DLDMFKDHCVLFLKHSNLLYVNVIGLADDSVRSLKLPPWACGFIMDTNSDPKNCPFQLCSPIRPPKYYTY    351 - 420
KFAEGKLFEETGHEDPITKTSRVLRLEAKSKDGKLVPMTVFHKTDSEDLQKKPLLVHVYGAYGMDLKMNF    421 - 490
RPERRVLVDDGWILAYCHVRGGGELGLQWHADGRLTKKLNGLADLEACIKTLHGQGFSQPSLTTLTAFSA    491 - 560
GGVLAGALCNSNPELVRAVTLEAPFLDVLNTMMDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCPYQNIK    561 - 630
PQHYPSIHITAYENDERVPLKGIVSYTEKLKEAIAEHAKDTGEGYQTPNIILDIQPGGNHVIEDSHKKIT    631 - 700
AQIKFLYEELGLDSTSVFEDLKKYLKF                                               701 - 727
//

Text Mined References (19)

PMID Year Title