Property Summary

NCBI Gene PubMed Count 54
PubMed Score 335.17
PubTator Score 470.21

Knowledge Summary

Patent

No data available

Expression

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
463149 other 3 / 0 / 21 Late stage assay provider results from the probe development effort to identify inhibitors of PME-1: Fluorescence-based biochemical gel-based ABPP inhibition and selectivity
651979 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA1: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ
651980 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify selective inhibitors of LYPLA2: LCMS-based cell-based Activity-Based Protein Profiling (ABPP) SILAC selectivity analysis in situ

Gene RIF (32)

PMID Text
26420028 This study found that circulating PREP activity was substantially reduced in all cirrhotic patients but those changes did not have evident correlation to hepatic encephalopathy.
26222144 TLR4 activation releases prolyl endopeptidase containing exosomes from airway epithelial cells.
26165750 PEP was significantly and positively associated with delinquent, aggressive, externalizing and internalizing behavior subscales.
25236746 PREP redox inactivation is due to oxidation of cysteine residues and consequent oligomerization through intermolecular disulfide bonds.
24931469 Data indicate that SAXS analysis showed that presequence protease (hPreP) open states and substrate binding dynamics.
24465166 The determination of PEP activity in the plasma may be a safe, minimally invasive and inexpensive way to define the aggressiveness of CRC in daily practice.
24269815 These results indicate that POP may be a positive regulator of cell cycle progression by regulating the exit from and/or reentry into the cell cycle by KATO III cells.
23643808 Oxidative stress and the levels of endogenous plasma prolyl oligopeptidase (PREP) inhibitor alpha-2-macroglobulin (alpha2M) decrease PREP activity in multiple sclerosis patients.
23562579 first demonstration of colocalization of PREP and pathological proteins in the human brain, supporting the view that, at least in spatial terms, PREP could be associated with pathogenesis of neurodegenerative diseases
23348613 interaction between prolyl oligopeptidase and glyceraldehyde-3-phosphate dehydrogenase is required for cytosine arabinoside-induced glyceraldehyde-3-phosphate dehydrogenase nuclear translocation and cell death
23041349 Redox control of hPreP in the mitochondrial matrix and the protective role of the conserved methionine 206 residue as an internal antioxidant.
22750443 analysis of the substrate preferences of two post-proline cleaving endopeptidases, prolyl oligopeptidase and fibroblast activation protein alpha
22740343 PREP may be associated with secretory processes as well as in reproduction. A more abundant expression of PREP in malignant than benign tumors suggests that PREP may be associated with expansion and metastasis of tumors.
22132071 Molecular modeling and docking based approaches were used to unravel questions like differences in ligand binding affinities in three POP species (porcine, human and A. thaliana).
21620802 These results indicate that POP is a part of the machinery that controls the cell cycle.
21487212 PREP is a regulatory target and a regulatory element in cell signalling. This is the first report of a direct influence of a cell signalling molecule, retinoic acid, on PREP expression.
20869470 Results indicate that there is no strong and direct interaction between POP and GAP43 at physiological conditions.
20534982 The constitutive expression of PREP mRNA in chronic lymphocytic leukemia was demonstrated.
20468064 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20370893 Plasma levels of PREP activity as well as those of their endogenous inhibitor are suggested as biomarkers of inflammation and oxidative stress in multiple sclerosis
20362629 Cytosolic Prolyl endopeptidase activity significantly increased in clear cell renal cell carcinoma, urothelial carcinoma of the renal pelvis and head and neck squamous cell carcinoma.
19795399 Observational study of gene-disease association. (HuGE Navigator)
19782684 Data reveal for the first time the presence of a new side opening in prolyl oligopeptidase that was not observed in any of the crystallographic structures described to date.
17454876 The results rule out a causative role of POP in the pathogenesis of CD and strongly suggest that other peptidases are needed to eliminate gliadin-derived, immunoactive and toxic peptides larger than 33-mer, which is a POP inhibitor.
17401647 Results describe the distribution of immunoreactive prolyl oligopeptidase in human and rat brain.
17324276 Observational study of gene-disease association. (HuGE Navigator)
16700513 data demonstrate for the first time prolyl endopeptidase turnover of humanin by a limited post-cysteine as well as post-proline proteolysis resulting in the inactivation of this potentially apoptosis-related factor
16092940 Mainly localized to perinuclear space and associated with microtubulin cytoskeleton in human neuroblastoma and glioma. Novel functions in axonal transport and/or protein secretion. PEP inhibitors may be useful in variety of related clinical conditions.
15838896 primary structure, recombinant expression and homology modelling of brain prolyl oligopeptidase
15380924 The activities of pyroglutamyl peptidase I and prolyl endopeptidase in necrozoospermia were found to be higher in the corresponding soluble and particulate sperm fractions, respectively, with respect to those measured in normozoospermic semen
11792464 The high activity of prolyl endopeptidase in the human cortex suggests that prolyl endopeptidase could play a role in cortical functions. Activity in humans is highest in the frontal lobe and cytosolic fractions.

AA Sequence

MLSLQYPDVYRDETAVQDYHGHKICDPYAWLEDPDSEQTKAFVEAQNKITVPFLEQCPIRGLYKERMTEL      1 - 70
YDYPKYSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLEGEARVFLDPNILSDDGTVALRGYAFSEDGEYFA     71 - 140
YGLSASGSDWVTIKFMKVDGAKELPDVLERVKFSCMAWTHDGKGMFYNSYPQQDGKSDGTETSTNLHQKL    141 - 210
YYHVLGTDQSEDILCAEFPDEPKWMGGAELSDDGRYVLLSIREGCDPVNRLWYCDLQQESSGIAGILKWV    211 - 280
KLIDNFEGEYDYVTNEGTVFTFKTNRQSPNYRVINIDFRDPEESKWKVLVPEHEKDVLEWIACVRSNFLV    281 - 350
LCYLHDVKNILQLHDLTTGALLKTFPLDVGSIVGYSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPR    351 - 420
VFREVTVKGIDASDYQTVQIFYPSKDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISITPNYSVSRLI    421 - 490
FVRHMGGILAVANIRGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKEGYTSPKRLTINGGSNGGLLV    491 - 560
AACANQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYGCSDSKQHFEWLVKYSPLHNVKLPEADDIQY    561 - 630
PSMLLLTADHDDRVVPLHSLKFIATLQYIVGRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFI    631 - 700
ARCLNVDWIP                                                                701 - 710
//

Text Mined References (60)

PMID Year Title
26420028 2015 The expression levels of prolyl oligopeptidase responds not only to neuroinflammation but also to systemic inflammation upon liver failure in rat models and cirrhotic patients.
26222144 2016 Toll-Like Receptor 4 Engagement Mediates Prolyl Endopeptidase Release from Airway Epithelia via Exosomes.
26165750 2015 Prolyl endopeptidase and dipeptidyl peptidase IV are associated with externalizing and aggressive behaviors in normal and autistic adolescents.
25236746 2014 Mechanism of oxidative inactivation of human presequence protease by hydrogen peroxide.
24931469 2014 Molecular basis of substrate recognition and degradation by human presequence protease.
24465166 2014 Prolyl endopeptidase activity is correlated with colorectal cancer prognosis.
24269815 2014 Prolyl oligopeptidase inhibition-induced growth arrest of human gastric cancer cells.
23643808 2013 Alteration of prolyl oligopeptidase and activated ?-2-macroglobulin in multiple sclerosis subtypes and in the clinically isolated syndrome.
23562579 2013 Prolyl oligopeptidase colocalizes with ?-synuclein, ?-amyloid, tau protein and astroglia in the post-mortem brain samples with Parkinson's and Alzheimer's diseases.
23348613 2013 Prolyl oligopeptidase is a glyceraldehyde-3-phosphate dehydrogenase-binding protein that regulates genotoxic stress-induced cell death.
23041349 2012 In vitro oxidative inactivation of human presequence protease (hPreP).
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22750443 2012 Comparative analysis of the substrate preferences of two post-proline cleaving endopeptidases, prolyl oligopeptidase and fibroblast activation protein ?.
22740343 2012 Distribution of prolyl oligopeptidase in human peripheral tissues and in ovarian and colorectal tumors.
22132071 2011 Structural analysis of prolyl oligopeptidases using molecular docking and dynamics: insights into conformational changes and ligand binding.
21620802 2011 Prolyl oligopeptidase participates in cell cycle progression in a human neuroblastoma cell line.
21487212 2011 Prolyl endopeptidase is involved in cellular signalling in human neuroblastoma SH-SY5Y cells.
21269460 2011 Initial characterization of the human central proteome.
20869470 2010 GAP43 shows partial co-localisation but no strong physical interaction with prolyl oligopeptidase.
20534982 2010 Expression and prognostic assessment of dipeptidyl peptidase IV and related enzymes in B-cell chronic lymphocytic leukemia.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20370893 2010 Prolyl oligopeptidase is inhibited in relapsing-remitting multiple sclerosis.
20362629 2010 Increased prolyl endopeptidase activity in human neoplasia.
20195514 2010 Genome-wide association study reveals multiple loci associated with primary tooth development during infancy.
19946888 2010 Defining the membrane proteome of NK cells.
19795399 2009 Genome-wide linkage scans for type 2 diabetes mellitus in four ethnically diverse populations-significant evidence for linkage on chromosome 4q in African Americans: the Family Investigation of Nephropathy and Diabetes Research Group.
19782684 2009 A new side opening on prolyl oligopeptidase revealed by electron microscopy.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18606544 2008 Pyrrolidinyl pyridone and pyrazinone analogues as potent inhibitors of prolyl oligopeptidase (POP).
17454876 2007 Deficient activity of mammalian prolyl oligopeptidase on the immunoactive peptide digestion in coeliac disease.
17401647 2007 Distribution of immunoreactive prolyl oligopeptidase in human and rat brain.
17324276 2007 No association between the PREP gene and lithium responsive bipolar disorder.
16700513 2006 Prolyl endopeptidase cleaves the apoptosis rescue peptide humanin and exhibits an unknown post-cysteine cleavage specificity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
16092940 2005 Subcellular localization suggests novel functions for prolyl endopeptidase in protein secretion.
15838896 2005 Primary structure, recombinant expression and homology modelling of human brain prolyl oligopeptidase, an important therapeutic target in the treatment of neuropsychiatric diseases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15380924 2004 Pyroglutamyl peptidase I and prolyl endopeptidase in human semen: increased activity in necrozoospermia.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12603817 2003 Effect of S 17092, a novel prolyl endopeptidase inhibitor, on substance P and alpha-melanocyte-stimulating hormone breakdown in the rat brain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11792464 2002 Distribution of prolyl endopeptidase activities in rat and human brain.
11137456 Characterization of a prolyl endopeptidase (kininase) from human urine using fluorogenic quenched substrates.
9695945 1998 Prolyl oligopeptidase: an unusual beta-propeller domain regulates proteolysis.
8893811 1996 Subregional mapping of the human lymphocyte prolyl oligopeptidase gene (PREP) to human chromosome 6q22.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8089089 1994 Molecular cloning and characterization of prolyl endopeptidase from human T cells.
7959018 1994 Cloning and sequence analysis of the gene encoding human lymphocyte prolyl endopeptidase.
7588785 1995 The purification, characterization and analysis of primary and secondary-structure of prolyl oligopeptidase from human lymphocytes. Evidence that the enzyme belongs to the alpha/beta hydrolase fold family.
6389730 1984 Purification and properties of a human placental post-proline endopeptidase.
6358755 1983 Prolyl endopeptidase.
3891453 1985 Characterization of proline endopeptidase from skeletal muscle.
3525564 1986 Purification and characterization of a novel neurotensin-degrading peptidase from rat brain synaptic membranes.
3480758 1987 Rapid degradation of D- and L-succinimide-containing peptides by a post-proline endopeptidase from human erythrocytes.
3292288 1988 Proline residues in the maturation and degradation of peptide hormones and neuropeptides.
2858361 1985 Proteases in human lenses and their possible significance.
12173 1976 Post-proline cleaving enzyme. Purification of this endopeptidase by affinity chromatography.