Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.14
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

AA Sequence

MGVSVDVHQVYKYPFEQVVASFLRKYPNPMDKNVISVKIMEEKRDESTGVIYRKRIAICQNVVPEILRKS      1 - 70
LSTLVILCWKKVSILKVPNIQLEEESWLNPRERNMAIRSHCLTWTQYASMKEESVFRESMENPNWTEFIQ     71 - 140
RGRISITGVGFLNCVLETFASTFLRQGAQKGIRIMEMLLKEQCGAPLAE                         141 - 189
//

Text Mined References (8)

PMID Year Title