Property Summary

NCBI Gene PubMed Count 14
PubMed Score 21.24
PubTator Score 6.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 1963 1.4e-07
ovarian cancer 8297 2.8e-06
non primary Sjogren syndrome sicca 861 1.7e-02
Disease Target Count Z-score Confidence
Exotropia 35 3.588 1.8
Esotropia 31 3.473 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.200 1.7e-02
ovarian cancer 2.200 2.8e-06
tuberculosis 1.400 1.4e-07

Gene RIF (5)

AA Sequence

MVKYFLGQSVLRSSWDQVFAAFWQRYPNPYSKHVLTEDIVHREVTPDQKLLSRRLLTKTNRMPRWAERLF      1 - 70
PANVAHSVYVLEDSIVDPQNQTMTTFTWNINHARLMVVEERCVYCVNSDNSGWTEIRREAWVSSSLFGVS     71 - 140
RAVQEFGLARFKSNVTKTMKGFEYILAKLQGEAPSKTLVETAKEAKEKAKETALAATEKAKDLASKAATK    141 - 210
KQQQQQQFV                                                                 211 - 219
//

Text Mined References (17)

PMID Year Title