Property Summary

NCBI Gene PubMed Count 50
PubMed Score 101.47
PubTator Score 93.43

Knowledge Summary

Patent

No data available

Expression

Gene RIF (41)

PMID Text
26261544 Positive Prx 4 expression is significantly correlated with recurrence and shorter disease-free survival in patients with early-stage lung squamous cell carcinoma.
25137134 An off-pathway reaction in the Prx4-mediated oxidative protein folding.
25122762 these data suggest an important role of Prdx4 in maintaining insulin levels and improving the ER folding capacity also under conditions of a high insulin requirement.
24893865 Findings suggest that elevated serum Prx4 levels are associated with a higher risk of incident type 2 diabetes
24617620 there is a significant difference in concentration of Prx4 between cardiac arrest patients with good and poor outcome
24586984 Prx4 is a circulating antioxidant and is independently associated with increased risk of cardiovascular and all-cause mortality in T2DM.
24450625 The structure and function of PRDX4 as well as its sensitivity to hyperoxidation. [Review]
24403061 peroxiredoxin IV recycling in the endoplasmic reticulum is much less efficient than in the cytosol or mitochondria, leading to the protection of peroxiredoxin IV from hyperoxidation.
24098506 expression of PRDX4 in PCOS ovaries appeared to be mediated through oxidative stress in GCs. We reported that the deficiency of antioxidant PRDX4 was associated with pathophysiological mechanism of PCOS.
23979138 Data indicate that protein disulfide isomerase (PDI) and ERp44 dynamically localize Ero1alpha and peroxiredoxin 4 in early secretory compartment (ESC).
23949117 Remarkably, the Prx4-dependent formation of native disulfide bonds was accelerated when PDI was combined with ERp46 or P5, suggesting that PDIs work synergistically to increase the rate and fidelity of oxidative protein folding.
23737084 expression of Prxs I and IV, both at mRNA and protein levels, was associated with light chain secretion quantified by ELISA.
23316297 Elevated serum Prx4 levels are associated with a significantly higher risk of incident cardiovascular disease (CVD) events or CVD mortality and all-cause mortality after adjustment for clinical risk factors.
23190175 these results indicate that two placental proteins, Prx3 and Prx4, may act as new placental immune targets. Production of antibodies against peroxiredoxins 3 and 4 may introduce a new autoimmune hypothesis in recurrent pregnancy loss.
22916164 data suggest that PRDX4 can be a novel target for glioblastoma multiforme therapies in the future
22424448 Reverse phase protein arrays verified that the overexpression of both PRDX3 and PRDX4 in prostate tumor samples is negatively correlated with the presence of the TMPRSS2-ERG gene fusion.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22190034 HIV-1 gp41 is identified to have a physical interaction with peroxiredoxin 4 (PRDX4) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22045733 Prdx4 inhibits G-CSF-induced signalling and proliferation in myeloid progenitors.
21994946 Crystal structure of reduced and of oxidized peroxiredoxin IV enzyme reveals a stable oxidized decamer and a non-disulfide-bonded intermediate in the catalytic cycle
21916849 This study solved crystal structures of human Prx4 in three different redox forms and characterized the reaction features of Prx4 with hydrogen peroxide.
21859152 Overexpression of PRDX4 and P4HA2 was significantly associated with lymphatic metastasis in oral cavity squamous cell carcinoma
21698479 A proteomic approach for identification and localization of the pericellular components of chondrocytes
21693047 Data show that Keap1 and PRDX IV were overexpressed in the TNBC cohort.
21487000 Srx-Prx IV axis is critical for lung cancer maintenance and metastasis, suggesting that targeting the Srx-Prx IV axis may provide unique effective strategies for cancer prevention and treatment.
21283726 strong reduction in PRDX4 expression levels in APL correlates with increased trimethylation of histone 3 lysine residue 27 and 4 at the transcriptional start site of PRDX4, indicative of a bivalent histone code involved in transcriptional silencing.
21283059 Elevated serum levels of the antioxidant Prx4 were associated with an increased disease severity and adverse outcome of critically ill patients with sepsis.
21057456 Here, the authors demonstrate that several members of the protein disulphide isomerase family are able to directly reduce this PrxIV disulphide and in the process become oxidized.
21031435 PRDXs exhibit differential expression in prostate tumors, with PRDX3 and 4 consistently upregulated.
20610706 These results suggest that Prdx-1 and Prdx-4 are essential for preventing respiratory syncytial virus-induced oxidative damage in a subset of nuclear intermediate filament and actin binding proteins in epithelial cells.
20446767 PRDX4 has a pivotal protective function against diabetes progression in this type 1 diabetes mellitus model
20237496 Observational study of gene-disease association. (HuGE Navigator)
20157331 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19364504 data suggested that TRAIL suppressed the PRDX4 gene at the transcriptional level and that downregulation of PRDX4 might facilitate cell death induced by TRAIL
18977241 Observational study of gene-disease association. (HuGE Navigator)
18272409 These results suggested that Prx IV involved in the 16alpha-OHE1-induced proliferation of MCF-7 cells has a proliferative effect and may be related to cancer development or progression.
18052930 Peroxiredoxin IV forms complex structures within the ER, consistent with the formation of homodecamers
17676665 HIV-1 gp41 is identified to have a physical interaction with peroxiredoxin 4 (PRDX4) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
17644091 PRDX4 interacts with and regulates TBXA2R.
17601350 Observational study of gene-disease association. (HuGE Navigator)
12080185 2-Cys Prxs act in a mutually nonredundant and sometimes stress-specific fashion to protect human cells from oxidant injury. The substantial resistance of human cells to hydroperoxides may result in part from the additive action of multiple Prxs

AA Sequence

MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVA      1 - 70
DHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRS     71 - 140
INTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGI    141 - 210
LRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN             211 - 271
//

Text Mined References (54)

PMID Year Title
26261544 2015 Peroxiredoxin 4 as an independent prognostic marker for survival in patients with early-stage lung squamous cell carcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25137134 2014 A novel reaction of peroxiredoxin 4 towards substrates in oxidative protein folding.
25122762 2014 Peroxiredoxin 4 improves insulin biosynthesis and glucose-induced insulin secretion in insulin-secreting INS-1E cells.
24893865 2014 Circulating peroxiredoxin 4 and type 2 diabetes risk: the Prevention of Renal and Vascular Endstage Disease (PREVEND) study.
24617620 2014 CT-proAVP (copeptin), MR-proANP and Peroxiredoxin 4 after cardiac arrest: release profiles and correlation to outcome.
24586984 2014 Serum peroxiredoxin 4: a marker of oxidative stress associated with mortality in type 2 diabetes (ZODIAC-28).
24450625 2014 Regulating the level of intracellular hydrogen peroxide: the role of peroxiredoxin IV.
24403061 2014 Lack of an efficient endoplasmic reticulum-localized recycling system protects peroxiredoxin IV from hyperoxidation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24098506 2013 Downregulated expression of peroxiredoxin 4 in granulosa cells from polycystic ovary syndrome.
23979138 2013 Dynamic regulation of Ero1? and peroxiredoxin 4 localization in the secretory pathway.
23949117 2013 Synergistic cooperation of PDI family members in peroxiredoxin 4-driven oxidative protein folding.
23737084 2013 Expression of peroxiredoxins I and IV in multiple myeloma: association with immunoglobulin accumulation.
23316297 2012 Peroxiredoxin 4, a novel circulating biomarker for oxidative stress and the risk of incident cardiovascular disease and all-cause mortality.
23190175 2013 Presence of autoantibody against two placental proteins, peroxiredoxin 3 and peroxiredoxin 4, in sera of recurrent pregnancy loss patients.
22916164 2012 Suppression of peroxiredoxin 4 in glioblastoma cells increases apoptosis and reduces tumor growth.
22424448 2012 Peroxiredoxins 3 and 4 are overexpressed in prostate cancer tissue and affect the proliferation of prostate cancer cells in vitro.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22045733 2011 Peroxiredoxin-controlled G-CSF signalling at the endoplasmic reticulum-early endosome interface.
21994946 2011 Crystal structure of reduced and of oxidized peroxiredoxin IV enzyme reveals a stable oxidized decamer and a non-disulfide-bonded intermediate in the catalytic cycle.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21916849 2012 Structural insights into the peroxidase activity and inactivation of human peroxiredoxin 4.
21859152 2011 Identification of PRDX4 and P4HA2 as metastasis-associated proteins in oral cavity squamous cell carcinoma by comparative tissue proteomics of microdissected specimens using iTRAQ technology.
21698479 2011 A proteomic approach for identification and localization of the pericellular components of chondrocytes.
21693047 2011 Oxidative stress and counteracting mechanisms in hormone receptor positive, triple-negative and basal-like breast carcinomas.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21487000 2011 Sulfiredoxin-Peroxiredoxin IV axis promotes human lung cancer progression through modulation of specific phosphokinase signaling.
21283726 2011 The antioxidant protein peroxiredoxin 4 is epigenetically down regulated in acute promyelocytic leukemia.
21283059 2011 Circulating levels of peroxiredoxin 4 as a novel biomarker of oxidative stress in patients with sepsis.
21269460 2011 Initial characterization of the human central proteome.
21057456 2010 Recycling of peroxiredoxin IV provides a novel pathway for disulphide formation in the endoplasmic reticulum.
21031435 2011 Differential expression of peroxiredoxins in prostate cancer: consistent upregulation of PRDX3 and PRDX4.
20610706 2010 Role of peroxiredoxin 1 and peroxiredoxin 4 in protection of respiratory syncytial virus-induced cysteinyl oxidation of nuclear cytoskeletal proteins.
20446767 2010 Overexpression of peroxiredoxin 4 protects against high-dose streptozotocin-induced diabetes by suppressing oxidative stress and cytokines in transgenic mice.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20157331 2010 SNPs in genes coding for ROS metabolism and signalling in association with docetaxel clearance.
19892738 2009 Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.
19364504 2009 TNF-related apoptosis-inducing ligand suppresses PRDX4 expression.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18272409 2008 Involvement of peroxiredoxin IV in the 16alpha-hydroxyestrone-induced proliferation of human MCF-7 breast cancer cells.
18052930 2008 Peroxiredoxin IV is an endoplasmic reticulum-localized enzyme forming oligomeric complexes in human cells.
17644091 2007 Peroxiredoxin-4 interacts with and regulates the thromboxane A(2) receptor.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
15952740 Protein profiling of human pancreatic islets by two-dimensional gel electrophoresis and mass spectrometry.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12927788 2003 hLodestar/HuF2 interacts with CDC5L and is involved in pre-mRNA splicing.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12080185 2002 Nonredundant antioxidant defense by multiple two-cysteine peroxiredoxins in human prostate cancer cells.
12059788 2002 A method for detection of overoxidation of cysteines: peroxiredoxins are oxidized in vivo at the active-site cysteine during oxidative stress.
11358524 2001 Possible involvement of the membrane-bound form of peroxiredoxin 4 in acrosome formation during spermiogenesis of rats.
9388242 1997 Regulatory role for a novel human thioredoxin peroxidase in NF-kappaB activation.