Property Summary

NCBI Gene PubMed Count 87
PubMed Score 186.90
PubTator Score 120.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.562 5.1e-03
Multiple myeloma 1.375 8.3e-03
hereditary spastic paraplegia -1.322 3.9e-04
pancreatic ductal adenocarcinoma liver m... -1.738 2.0e-02
lung cancer 1.100 4.6e-03
aldosterone-producing adenoma -1.056 4.6e-02
acute myeloid leukemia -1.400 2.2e-02
ovarian cancer -1.900 1.9e-04

Protein-protein Interaction (7)

Gene RIF (62)

PMID Text
26797130 Oxidative stress promotes PRX2 and PRX3 hyperoxidation and attenuates pro-survival signaling in aging chondrocytes.
26614766 the species with one disulfide and one hyperoxidized active site was decameric for Prx2 and dimeric for Prx3. Reduction and re-oxidation of the hyperoxidized dimer of Prx3 produced hyperoxidized monomers
26350748 We also found that forkhead box protein 1 (FOXM1)-induced peroxiredoxin 3 (PRDX3) maintains the mitochondrial function, and the FOXM1/PRDX3 mitochondrial pathway maintains survival of colon CSCs
26091938 Colon cancer stem cells overexpress the mitochondrial gene PRX3, which is required for maintenance of mitochondrial function and tumorigenesis, and is regulated by forkhead box protein 1, which also regulates expression of CD133 in these cells.
25743848 High serum PRDX3 levels are associated with hepatocellular carcinoma.
25462069 Peroxiredoxin 3 levels regulate a mitochondrial redox setpoint in malignant mesothelioma cells.
25323516 two placental proteins, Prx3 and Prx4, may act as new placental immune targets.
25093297 HIF-1alpha is a transcription factor for PRDX3 gene expression in clear cell renal cell carcinoma.
24828865 Data indicate that peroxiredoxin III (PrxIII) is a common direct target of both miroRNAs miR-26a-5p and miR-23b-3p.
24815434 Serum PRDX3 can be used as a noninvasive biomarker for the diagnosis and/or prognosis of hepatocellular carcinoma.
24105047 High peroxiredoxin 3 protein expression is associated with hepatocellular carcinoma.
24003226 Data indicate that engineered Prx2 and Prx3 variants C-terminal residues modulate the extent of hyperoxidation.
23880827 Results suggest that PRDX-3 has an essential role in regulating oxidation-induced apoptosis in antiandrogen-resistant prostate cancer cells.
23564483 peroxiredoxin III may be associated with drug resistance in ovarian cancer
23503975 The silencing of PRDX3 triggered cisplatinmediated apoptosis in the ovarian cancer cells, which may act through suppression of the NFkappaB signaling pathway.
23190175 these results indicate that two placental proteins, Prx3 and Prx4, may act as new placental immune targets. Production of antibodies against peroxiredoxins 3 and 4 may introduce a new autoimmune hypothesis in recurrent pregnancy loss.
23157748 Medulloblastoma tumors exhibit decreased expression of miR-383 but elevated expression of PRDX3. Up-regulation of miR-383 knocks down the expression of PRDX3, inhibits cell proliferation and promotes apoptosis.
23113308 Drug resistance formation was accompanied by a significant increase in the expression of PRDX1, PRDX2, PRDX3, PRDX6 genes in all cancer cell strains, which confirms the importance of redox-dependent mechanisms into development of cisplatin resistance.
23018647 A fraction of FOXM1 coexists in the cytoplasm with mitochondrial peroxiredoxin 3.
22710126 the effects of PRDX3 in PCa progression may be caused by the regulation function of miR-23b, and consequently, miR-23b may be involved in the response of PCa cells to hypoxia stress
22496757 Single nucleotide polymorphisms in the PRDX3 and RPS19 is associated with HPV persistence and cervical precancer/cancer.
22424448 Reverse phase protein arrays verified that the overexpression of both PRDX3 and PRDX4 in prostate tumor samples is negatively correlated with the presence of the TMPRSS2-ERG gene fusion.
22344546 The results indicated that overexpression of PRDX3 was associated with 94.9% hepatocellular carcinoma, and correlated with poor differentiation (P<0.05), which suggest that PRDX3 has substantial clinical impact on the progression of hepatocarcinoma.
22016591 Report nuclear factor E2-related factor 2 dependent overexpression of sulfiredoxin and peroxiredoxin III in human lung cancer.
21795677 Cullin 4B protein ubiquitin ligase targets peroxiredoxin III for degradation.
21385867 Model for the exceptional reactivity of peroxiredoxins 2 and 3 with hydrogen peroxide: a kinetic and computational study.
21220625 Paraneoplastic autoimmune reaction against retinal pigment epithelium, with PRDX3 as the putative antigen, may be a cause of acute exudative polymorphous vitelliform maculopathy (AEPVM).
21127481 The interaction between genetic variations in the PRDX3 gene and dietary fat intake is important for modulation of BMI and obesity risk.
21031435 PRDXs exhibit differential expression in prostate tumors, with PRDX3 and 4 consistently upregulated.
20929858 Both thioredoxin 2 and glutaredoxin 2 contribute to the reduction of the mitochondrial 2-Cys peroxiredoxin Prx3.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20840079 Prx3, which resides within mitochondria, were reacted with a selection of hydroperoxides generated by gamma-radiolysis or singlet oxygen, on free amino acids, peptides and proteins.
20718351 Peroxiredoxin III was significantly up-regulated in cervical cancer tissues.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20043069 Peroxiredoxin III has a significant role in cell cycle regulation and could be a potential proliferation marker in breast cancer.
19819956 Prx3 knockdown resulted in a 50% decrease in D3-mediated whole-cell deiodination.
19462976 We found that Prx 3 displayed strong reactivity with H(2)O(2), with a competitive kinetic approach generating a second order rate constant of 2 x 10(7) M(-1) s(-1). This is higher than typical thiols and similar to values for other mammalian 2-Cys Prxs
19460752 Knockdown of peroxiredoxin 3 (PRDX3; PRO1748) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
19424615 Conclude that Prx II and III are upregulated in response to the development of cervical cancer.
19176523 Srx plays a crucial role in the reactivation of sulfinic mitochondrial Prx III and that its mitochondrial translocation is critical in maintaining the balance between mitochondrial H(2)O(2) production and elimination
19135121 Report the effects of acrolein on peroxiredoxins, thioredoxins, and thioredoxin reductase in human bronchial epithelial cells.
18977241 Observational study of gene-disease association. (HuGE Navigator)
18778410 As a result of increased Prdx3 transgene expression, mitochondria from transgenic mice produce a significantly reduced amount of hydrogen peroxide and cells from transgenic (PRDX3) mice have increased resistance to stress-induced cell death and apoptosis.
18378575 Significantly decreased expression of Prx-2, -3, and -5 in FED may suggest an alteration in the ability of endothelial cells to withstand oxidant-induced damage and may be closely related to the pathogenesis of this disease.
18262354 Our results show that mitochondrial PRDX-depleted cells are more prone to oxidative damages and apoptosis induced by MPP(+), a complex I inhibitor which provides an experimental paradigm of Parkinson's disease.
18205602 coexpression of AOP-1 inhibited TNNI3K kinase activity
18195003 FOXO3A mediates Prx III expression, and this may play a critical role in the resistance to oxidative stress in cardiac fibroblasts
17893648 Present throughout lens and localized to mitochondria in lens epithelial cells. Induction is acute response of lens to increased H2O2. Important role in lens H2O2-detoxification, mitochondrial maintenance, and possibly cataract formation.
17676665 HIV-1 gp120 upregulates the expression of peroxiredoxin 1, 3, and 4 proteins in umbilical cord blood mononuclear cells and T-cell lines
17601350 Observational study of gene-disease association. (HuGE Navigator)
17574212 Finally, the expression level of beta-globin and GATA-1 was dramatically increased in Prdx III O/E cell line.
17548047 The additive protection by Trx2 and GSH shows that Trx2 and GSH systems are both functionally important at low oxidative stress conditions.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15750338 findings indicate that RPK118 is a PRDX3-binding protein that may be involved in transporting PRDX3 from the cytoplasm to its mitochondrial site of function or to other membrane structures via endosome trafficking.
15280382 Peroxiredoxin III is a critical regulator of the abundance of mitochondrial H(2)O(2), which itself promotes apoptosis in cooperation with other mediators of apoptotic signaling
12650976 The level of peroxiredoxin 3 is decreased in the frontal cortex of patients with Down syndrome and Pick's disease.
12530083 Mitochondrial thioredoxin reductase and peroxiredoxin III are overexpressed in hepatocellular carcinomas.
12492477 LZK was associated directly with the IKK complex through the kinase domain, and that AOP-1 was recruited to the IKK complex through the binding to LZK.
12080185 2-Cys Prxs act in a mutually nonredundant and sometimes stress-specific fashion to protect human cells from oxidant injury. The substantial resistance of human cells to hydroperoxides may result in part from the additive action of multiple Prxs
12011429 PRDX3 is a c-Myc target gene that is requried to maintain normal mitochondrial function. c-Myc directly activates expression of a mitochondrial peroxiredoxin that is required for Myc-mediated transformation.
11904290 Proteomics analysis of cellular response to oxidative stress. Evidence for in vivo overoxidation of peroxiredoxins at their active site
11771746 Protein levels of Prx-III, a mitochondrial protein were significantly decreased in Alzheimer Disease and Down Syndrome.

AA Sequence

MAAAVGRLLRASVARHVSAIPWGISATAALRPAACGRTSLTNLLCSGSSQAKLFSTSSSCHAPAVTQHAP      1 - 70
YFKGTAVVNGEFKDLSLDDFKGKYLVLFFYPLDFTFVCPTEIVAFSDKANEFHDVNCEVVAVSVDSHFSH     71 - 140
LAWINTPRKNGGLGHMNIALLSDLTKQISRDYGVLLEGSGLALRGLFIIDPNGVIKHLSVNDLPVGRSVE    141 - 210
ETLRLVKAFQYVETHGEVCPANWTPDSPTIKPSPAASKEYFQKVNQ                            211 - 256
//

Text Mined References (93)

PMID Year Title
26797130 2016 Oxidative Stress Promotes Peroxiredoxin Hyperoxidation and Attenuates Pro-survival Signaling in Aging Chondrocytes.
26614766 2016 Kinetic analysis of structural influences on the susceptibility of peroxiredoxins 2 and 3 to hyperoxidation.
26350748 2015 Mitochondrial metabolism in cancer stem cells: a therapeutic target for colon cancer.
26091938 2015 FOXM1-Induced PRX3 Regulates Stemness and Survival of Colon Cancer Cells via Maintenance of Mitochondrial Function.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25743848 2015 Plasma nuclear factor kappa B and serum peroxiredoxin 3 in early diagnosis of hepatocellular carcinoma.
25462069 2014 Peroxiredoxin 3 levels regulate a mitochondrial redox setpoint in malignant mesothelioma cells.
25416956 2014 A proteome-scale map of the human interactome network.
25323516 2015 Preoxiredoxin family members (Prx3 and Prx4) and pregnancy disorder (recurrent pregnancy loss).
25229973 2014 Forkhead box M1 regulates quiescence-associated radioresistance of human head and neck squamous carcinoma cells.
25093297 2014 Hypoxia inducible factor-1? suppresses Peroxiredoxin 3 expression to promote proliferation of CCRCC cells.
24828865 2015 MicroRNA-26a-5p and microRNA-23b-3p up-regulate peroxiredoxin III in acute myeloid leukemia.
24815434 2014 Serum peroxiredoxin3 is a useful biomarker for early diagnosis and assessemnt of prognosis of hepatocellular carcinoma in Chinese patients.
24789097 2014 Peroxiredoxin proteins protect MCF-7 breast cancer cells from doxorubicin-induced toxicity.
24773279 2014 Comparative study of Hsp27, GSK3?, Wnt1 and PRDX3 in Hirschsprung's disease.
24698430 2014 Oxidative stress markers and mitochondrial antioxidant enzyme expression are increased in aggressive Hodgkin lymphomas.
24459295 2014 Thiol peroxidases ameliorate LRRK2 mutant-induced mitochondrial and dopaminergic neuronal degeneration in Drosophila.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24105047 2014 Peroxiredoxin 3 is resistant to oxidation-induced apoptosis of Hep-3b cells.
24003226 2013 Molecular basis for the resistance of human mitochondrial 2-Cys peroxiredoxin 3 to hyperoxidation.
23880827 2013 Peroxiredoxin-3 is overexpressed in prostate cancer and promotes cancer cell survival by protecting cells from oxidative stress.
23564483 2013 Peroxiredoxin III protein expression is associated with platinum resistance in epithelial ovarian cancer.
23503975 2013 siRNA targeting of PRDX3 enhances cisplatin?induced apoptosis in ovarian cancer cells through the suppression of the NF??B signaling pathway.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23190175 2013 Presence of autoantibody against two placental proteins, peroxiredoxin 3 and peroxiredoxin 4, in sera of recurrent pregnancy loss patients.
23157748 2012 [MicroRNA383 regulates expression of PRDX3 in human medulloblastomas].
23113308 2012 Expression of peroxiredoxin 1, 2, 3, and 6 genes in cancer cells during drug resistance formation.
23018647 2013 Mitochondrial-targeted nitroxides disrupt mitochondrial architecture and inhibit expression of peroxiredoxin 3 and FOXM1 in malignant mesothelioma cells.
22710126 2012 MicroRNA-23b downregulates peroxiredoxin III in human prostate cancer.
22628295 2012 Oxidative stress in Fanconi anaemia: from cells and molecules towards prospects in clinical management.
22496757 2012 Single nucleotide polymorphisms in the PRDX3 and RPS19 and risk of HPV persistence and cervical precancer/cancer.
22424448 2012 Peroxiredoxins 3 and 4 are overexpressed in prostate cancer tissue and affect the proliferation of prostate cancer cells in vitro.
22344546 2012 Detection and identification of peroxiredoxin 3 as a biomarker in hepatocellular carcinoma by a proteomic approach.
22016591 2011 Nuclear factor E2-related factor 2 dependent overexpression of sulfiredoxin and peroxiredoxin III in human lung cancer.
21850687 2011 Mutations in LRRK2 increase phosphorylation of peroxiredoxin 3 exacerbating oxidative stress-induced neuronal death.
21795677 2011 Cullin 4B protein ubiquitin ligase targets peroxiredoxin III for degradation.
21385867 2011 Model for the exceptional reactivity of peroxiredoxins 2 and 3 with hydrogen peroxide: a kinetic and computational study.
21269460 2011 Initial characterization of the human central proteome.
21220625 2011 Anti-retinal pigment epithelium antibodies in acute exudative polymorphous vitelliform maculopathy: a new hypothesis about disease pathogenesis.
21127481 2011 The combination of genetic variations in the PRDX3 gene and dietary fat intake contribute to obesity risk.
21031435 2011 Differential expression of peroxiredoxins in prostate cancer: consistent upregulation of PRDX3 and PRDX4.
20929858 2010 Both thioredoxin 2 and glutaredoxin 2 contribute to the reduction of the mitochondrial 2-Cys peroxiredoxin Prx3.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20873783 2010 Characterization of hNek6 interactome reveals an important role for its short N-terminal domain and colocalization with proteins at the centrosome.
20840079 2010 Removal of amino acid, peptide and protein hydroperoxides by reaction with peroxiredoxins 2 and 3.
20718351 2009 [Expression of peroxiredoxin III in cervical lesions].
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20043069 2010 Silencing the Peroxiredoxin III gene inhibits cell proliferation in breast cancer.
19819956 2009 Knockdown of the type 3 iodothyronine deiodinase (D3) interacting protein peroxiredoxin 3 decreases D3-mediated deiodination in intact cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19462976 2009 Redox potential and peroxide reactivity of human peroxiredoxin 3.
19424615 2009 Expression of human peroxiredoxin isoforms in response to cervical carcinogenesis.
19176523 2009 Sulfiredoxin Translocation into Mitochondria Plays a Crucial Role in Reducing Hyperoxidized Peroxiredoxin III.
19135121 2009 The effects of acrolein on peroxiredoxins, thioredoxins, and thioredoxin reductase in human bronchial epithelial cells.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18778410 2008 Reduction of mitochondrial H2O2 by overexpressing peroxiredoxin 3 improves glucose tolerance in mice.
18378575 2008 Decreased expression of peroxiredoxins in Fuchs' endothelial dystrophy.
18262354 2008 Silencing of peroxiredoxin 3 and peroxiredoxin 5 reveals the role of mitochondrial peroxiredoxins in the protection of human neuroblastoma SH-SY5Y cells toward MPP+.
18205602 2007 AOP-1 interacts with cardiac-specific protein kinase TNNI3K and down-regulates its kinase activity.
18195003 2008 FOXO3A regulates peroxiredoxin III expression in human cardiac fibroblasts.
18084904 2007 Stress-induced peroxiredoxins.
18084903 2007 Peroxiredoxins in the central nervous system.
17893648 2007 Localization and H2O2-specific induction of PRDX3 in the eye lens.
17707404 2007 Reconstitution of the mitochondrial PrxIII antioxidant defence pathway: general properties and factors affecting PrxIII activity and oligomeric state.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
17574212 2007 The role of peroxiredoxin III on late stage of proerythrocyte differentiation.
17548047 2007 Mitochondrial thioredoxin-2/peroxiredoxin-3 system functions in parallel with mitochondrial GSH system in protection against oxidative stress.
17060495 2006 Defective mitochondrial peroxiredoxin-3 results in sensitivity to oxidative stress in Fanconi anemia.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15750338 2005 RPK118, a PX domain-containing protein, interacts with peroxiredoxin-3 through pseudo-kinase domains.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15280382 2004 Peroxiredoxin III, a mitochondrion-specific peroxidase, regulates apoptotic signaling by mitochondria.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12650976 2003 Aberrant expression of peroxiredoxin subtypes in neurodegenerative disorders.
12530083 Overexpression of mitochondrial thioredoxin reductase and peroxiredoxin III in hepatocellular carcinomas.
12492477 2003 Mixed lineage kinase LZK and antioxidant protein-1 activate NF-kappaB synergistically.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12080185 2002 Nonredundant antioxidant defense by multiple two-cysteine peroxiredoxins in human prostate cancer cells.
12059788 2002 A method for detection of overoxidation of cysteines: peroxiredoxins are oxidized in vivo at the active-site cysteine during oxidative stress.
12011429 2002 The c-Myc target gene PRDX3 is required for mitochondrial homeostasis and neoplastic transformation.
11904290 2002 Proteomics analysis of cellular response to oxidative stress. Evidence for in vivo overoxidation of peroxiredoxins at their active site.
11771746 2001 Protein levels of human peroxiredoxin subtypes in brains of patients with Alzheimer's disease and Down syndrome.
11591653 2001 Protein-protein interaction panel using mouse full-length cDNAs.
11285261 2001 Abrin triggers cell death by inactivating a thiol-specific antioxidant protein.
10521424 1999 Cloning and characterization of AOEB166, a novel mammalian antioxidant enzyme of the peroxiredoxin family.
10514471 1999 Characterization of human and murine PMP20 peroxisomal proteins that exhibit antioxidant activity in vitro.
9363753 1997 SP-22 is a thioredoxin-dependent peroxide reductase in mitochondria.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7733872 1995 Mammalian antioxidant protein complements alkylhydroperoxide reductase (ahpC) mutation in Escherichia coli.
1286669 1992 Human liver protein map: a reference database established by microsequencing and gel comparison.